Conserved Protein Domain Family
Cyt_b561_CYB561

?
cd08763: Cyt_b561_CYB561 
Vertebrate cytochrome b(561), CYB561 gene product
Cytochrome b(561), as found in vertebrates, which might act as a ferric-chelate reductase, catalyzing the reduction of Fe(3+) to Fe(2+), such as associated with the transport of iron from the endosome to the cytoplasm. It is assumed that this protein uses ascorbate as the electron donor. Belongs to the cytochrome b(561) family, which are secretory vesicle-specific electron transport proteins. Cytochromes b(561) are integral membrane proteins that bind two heme groups non-covalently, and may have six alpha-helical trans-membrane segments.
Statistics
?
PSSM-Id: 176493
View PSSM: cd08763
Aligned: 3 rows
Threshold Bit Score: 229.702
Threshold Setting Gi: 192455664
Created: 29-Apr-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative heme
Feature 1:putative heme binding sites [chemical binding site]
Evidence:
  • Comment:four conserved histidines may be involved in heme coordination

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                  #                                 #                                 # 
P49447        44 WESDL-QFNAHPLCMVIGLIFLQGNALLVYRVFRNEAKRTTKVLHGLLHIFALVIALVGLVAVFDYHRKKGYADLYSLHS 122 human
Q91577        44 WSGPL-QFNVHPLCMVLGMVFLCGEALLVYRVFRHETKRSTKILHGVLHIMALVISLVGVIAVFQYHQANGYPDMYSLHS 122 African clawed ...
NP_001122216  38 WDGSAqEFNVHPLCMVLGLVFLYGDAVLVYRVFRNESKRSVKILHALLHMMALVISIVGLVAVFDFHSSSKISHMYSLHS 117 zebrafish
Feature 1                                             #                          
P49447       123 WCGILVFVLYFVQWLVGFSFFLFPGASFSLRSrYRPQHIFFGATIFLLSVGTALLGLKEALLFN 186 human
Q91577       123 WCGIVTFTLYILQWIIGFSLFFIPGVAFTYRSqFKPLHEFFGRALFLSSIATSLLGLTEKMFSE 186 African clawed frog
NP_001122216 118 WCGMLTFVLFFLQWLLGLGFFLFPWASAQLKSwYLPLHVFFGLLLLVMSVGSCLLGITEKLLFN 181 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap