Conserved Protein Domain Family
APC10-ZZEF1

?
cd08667: APC10-ZZEF1 
APC10/DOC1-like domain of uncharacterized Zinc finger ZZ-type and EF-hand domain-containing protein 1 (ZZEF1) and homologs.
This model represents the APC10/DOC1-like domain present in the uncharacterized Zinc finger ZZ-type and EF-hand domain-containing protein 1 (ZZEF1) of Mus musculus. Members of this family contain EF-hand, APC10, CUB, and zinc finger ZZ-type domains. ZZEF1-like APC10 domains are homologous to the APC10 subunit/DOC1 domains present in E3 ubiquitin ligases, which mediate substrate ubiquitination (or ubiquitylation), and are components of the ubiquitin-26S proteasome pathway for selective proteolytic degradation.
Statistics
?
PSSM-Id: 176488
View PSSM: cd08667
Aligned: 5 rows
Threshold Bit Score: 251.363
Threshold Setting Gi: 195999756
Created: 4-Mar-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative ligand
Feature 1:putative ligand binding site [chemical binding site]
Evidence:
  • Comment:based on sequence homology to the protein structure of APC10 subunit of the human anaphase-promoting complex.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                   #                           #     # #                 
Q5SSH7        250 TKCYAYIETSSNPADIYRMTNGETSSYWQSDGSARSHWIRLKMKPDVVLRHLSIAVAATDQSYMPQQVTVAVGRSASDLQ 329  house mouse
XP_415744     247 TKCYTHIETSSNSADIDKMTNGETTSFWQSDGSARSHWIRLKMKPDVVLRHLSIAVAANDQSYMPQQVTVAVGRNASSLQ 326  chicken
XP_002604294  239 SKCYKGIDVSTNKADVHRMTDGDMSTYWQSDGTSRSHWVRIHMKPNVVLKQLAIHVQSSDQSYMPQTVTVSVGKSPTSLH 318  Florida lancelet
XP_002109746  251 LKCHQKLEVSSNSDTLNNLLDGNFHTCWQSDGITGTHWIRLSIKPDVELTELSIYVVPVDQSYMPKQVSVSAGFDADSVN 330  Trichoplax ad...
O43149        250 AKCYAYIETSSNSADIDKMTNGETSSYWQSDGSACSHWIRLKMKPDVVLRHLSIAVAATDQSYMPQQVTVAVGRNASDLQ 329  human
Feature 1                                                    #        
Q5SSH7        330 EVRDVHIPSnvTGYVTLLENAN-ISQLYVQINIKRCLSDGCDTRIHGLRAVG 380  house mouse
XP_415744     327 EVRDVHIPSniTGYVTLLENAN-ISQMYVQINIKRCLSDGCDTRIHGLRAIG 377  chicken
XP_002604294  319 EIKEVRIPShvTGDVTLLENAR-MHYPVVQINIRRCHSDGCDTRIHGLKTLG 369  Florida lancelet
XP_002109746  331 IVSTVTIPNshHGYFKVYERHSnTSYTVFQINIQRCHSGGCDTRIRGIKTIG 382  Trichoplax adhaerens
O43149        330 EVRDVHIPSnvTGYVTLLENAN-VSQLYVQINIKRCLSDGCDTRIHGLRAVG 380  human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap