Conserved Protein Domain Family
APC10-HERC2

?
cd08664: APC10-HERC2 
APC10-like DOC1 domain present in HERC2 (HECT domain and RLD2).
This model represents the APC10/DOC1 domain present in HERC2 (HECT domain and RLD2), a large multi-domain protein with three RCC1-like domains (RLDs), additional internal domains including a zinc finger ZZ-type and Cyt-b5 (Cytochrome b5-like Heme/Steroid binding) domains, and a C-terminal HECT (Homologous to the E6-AP Carboxyl Terminus) domain. The APC10/DOC1 domain of HERC2 is a homolog of the APC10 subunit and the DOC1 domain present in E3 ubiquitin ligases which mediate substrate ubiquitination (or ubiquitylation), a component of the ubiquitin-26S proteasome pathway for selective proteolytic degradation. As suggested by structural relationships between HERC2 and other proteins such as HERC1, the proposed role for HERC2 in protein trafficking and degradation pathways is consistent with observations that mutations in HERC2 lead to neuromuscular secretory vesicle and sperm acrosome defects, other developmental abnormalities, and juvenile lethality of jdf2 mice. Recent studies have shown that the protein complex, HERC2-RNF8, coordinates ubiquitin-dependent assembly of DNA repair factors on damaged chromosomes.
Statistics
?
PSSM-Id: 176485
View PSSM: cd08664
Aligned: 11 rows
Threshold Bit Score: 227.257
Threshold Setting Gi: 196005109
Created: 4-Mar-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative ligand
Feature 1:putative ligand binding site [chemical binding site]
Evidence:
  • Comment:based on sequence homology to the protein structure of APC10 subunit of the human anaphase-promoting complex.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                             #           
O95714       2765 KQLKRCHSSQp------------------------gMLLDSWSRMVKSLNVSSSVnQASRLIDg-sEPCWQSSGs----- 2814 human
XP_395007    2709 GKPGRYHRQDyi----------------------esSLIDDWSKCIRTLRVSSPQsWATRLFDg-tGLYWQSPQ------ 2759 honey bee
XP_001233308 2769 KQLKRRHSSQr------------------------gMLLDDWSRIVKNLNVSSSVnQASRLIDg-sEQCWQSSGs----- 2818 chicken
NP_608388    2762 QPAWQGHINEvelvasqptsatlpslgdscsqmppsDLIEDWSRCIRSLTVSSNEaAAKHLLNg-sNQPWQSCSsg---- 2836 fruit fly
XP_001861523 2699 QTVWNGHLNElelisnpls--------fggsgqgvfDIIDDWSRCIRSLTVSSNEsSAKYLLDr-sTNYWQSSSt----- 2764 southern hous...
XP_002427731 2786 GKPGKYHHAKqlestp---------------vadevGIIDDWARCIKTLTVSSREnWAHRLLDe-sGLFWESCGp----- 2844 human body louse
EEZ97761     1858 GKAGKYCRHDtfe--------------------gegELISDWGKCVRNVTVSSKY-AAKFEIP---GSIWQSCGs----- 1908 red flour beetle
XP_001629259 2223 GKPGRGRSRPsvap------------------asgdVIMKDWGRVVKNLTVSSREsQAAKLFDg-tESYWQSSGp----- 2278 starlet sea a...
XP_002112421 2669 SEPVAAHRRDphrnk----------------kkntnTVYRAWNDCVRSVSVSSNSiQAKCLYDdkeSTFWQSSGk----- 2727 Trichoplax ad...
CAG01384     2528 KQLKKHHSSQr------------------------gMLIDEWSRAVKSLNVSSSIhQASRLIDc-sDQCWQSSGsqgka- 2581 spotted green...
XP_002611352 1914 GRPGKYHKKGtnl---------------------tgTLVDEWSRCVRNLTVSSREnQASRLIDg-rGSYWQSSGsqgkca 1971 Florida lancelet
Feature 1                                               #     # #                                 
O95714       2815 -----------------qGKHWIRLEIFPDVLVHRLKMIVDPaDSSYMPSLVVVSGGnsLNNLIELKTININPSDTTVPL 2877 human
XP_395007    2760 ------------------GKHWIRMEMLSGILVHSLKIIVNPqDGSYMPSLIAINVGesFNSLVELATISVRHTDTSVLL 2821 honey bee
XP_001233308 2819 -----------------qGKHWIRLEIFPDVLVHRLKMVVDPaDSSYMPSLVVVSGGssLNNLIELKTININPTDTTVPL 2881 chicken
NP_608388    2837 -----------------pCRHWIRLELHDRILVHSLTLKVSPeDHSHMPSLLEIRVGdcVDSLKEYTWIPVPAGASRVLL 2899 fruit fly
XP_001861523 2765 -----------------qGKHWIRLEIHDQVFIQTLSINVDPdDYSHMPSLVVIRGGdsVATLKELHWVSINPTDVVVQL 2827 southern hous...
XP_002427731 2845 -----------------kEKHWIRLEMHQDILIKSLKILLDPlDNSYMPSLIIVYGGdtFSSLIELATINIRNTDTLVTL 2907 human body louse
EEZ97761     1909 -----------------qGKHWIRLEIYPDVVIKSLKLGVDPaDNSYMPSVIVVNGGstLNSLQELNVINVKSHDTSVTL 1971 red flour beetle
XP_001629259 2279 -----------------qGKHWIRLELFPDLLIHRLCMTVDPsDSSYMPSLVVISGGdtVSRLKDIKTVHIGSSDSLVTL 2341 starlet sea a...
XP_002112421 2728 -----------------qGKHWILLELNANLLIHQLSIDIKPsDSSYMPSVVVVSGGnsMMNLKPLNTIKVGAHDLRITL 2790 Trichoplax ad...
CAG01384     2582 -------------rhlpaPCHWIRLEIFPDVLVHRLKMTVDPaDSSYMPSLVVVSGGssLNNLIELKTININPTDTNALL 2648 spotted green...
XP_002611352 1972 cgerekdtpsrcslhgfpLQHWIRLELQPDIIVHRLRMQVDPaDSSYMPSLVVISGGdlLSNLKEVRTVHVSATDTLVTL 2051 Florida lancelet
Feature 1                                  #       
O95714       2878 LNDYTEYHRYIEIAIKQCRSSGIDCKIHGLILL 2910 human
XP_395007    2822 LQDMKEYYPCIEIAIKQCRNGGIDCKIRGLQII 2854 honey bee
XP_001233308 2882 LSDCTEYHRYIEIAIKQCRSSGIDCKIHGLSIL 2914 chicken
NP_608388    2900 MQQVPTYYPWVEVVVKQCQNNGIQCKIHGIKFV 2932 fruit fly
XP_001861523 2828 LNDCKQYYAWIEILVKQCRNNGIQCKIHGLNII 2860 southern house mosquito
XP_002427731 2908 LSDVKEFYSCIEIAIKQCWNGGINCKIHSLLIT 2940 human body louse
EEZ97761     1972 LTNLDKYYSIIEINIAKCRNNGIDCKIHGMTIL 2004 red flour beetle
XP_001629259 2342 LEEAPEEYRYIEISIRQCKSSGIDCKVHGLTIS 2374 starlet sea anemone
XP_002112421 2791 LENQSEEMKLIEIAIRHCKCNGIDCRVHSINIA 2823 Trichoplax adhaerens
CAG01384     2649 LNDCTEYHRYIEIAIKQCRSSGIDCKVHGLSII 2681 spotted green pufferfish
XP_002611352 2052 LQDVTEYYRFLEISIKQCRSSGIDCKIHGLSVV 2084 Florida lancelet

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap