Conserved Protein Domain Family
PI-PLCc_eta2

?
cd08633: PI-PLCc_eta2 
Catalytic domain of metazoan phosphoinositide-specific phospholipase C-eta2
This subfamily corresponds to the catalytic domain present in metazoan phosphoinositide-specific phospholipase C (PI-PLC, EC 3.1.4.11)-eta isozyme 2. PI-PLC is a signaling enzyme that hydrolyzes the membrane phospholipids phosphatidylinositol-4,5-bisphosphate (PIP2) to generate two important second messengers in eukaryotic signal transduction cascades, Inositol 1,4,5-trisphosphate (InsP3) and diacylglycerol (DAG). InsP3 triggers inflow of calcium from intracellular stores, while DAG, together with calcium, activates protein kinase C, which then phosphorylates other molecules, leading to altered cellular activity. Calcium is required for the catalysis. PI-PLC-eta represents a class of neuron-speific PI-PLC that has an N-terminal pleckstrin homology (PH) domain, an array of EF hands, a PLC catalytic core domain, a C2 domain, and a unique C-terminal tail that terminates with a PDZ-binding motif, a potential interaction site for other signaling proteins. The PLC catalytic core domain is a TIM barrel with two highly conserved regions (X and Y) split by a highly degenerate linker sequence. PI-PLC-eta2 is a neuron-specific enzyme and expressed in the brain. It may in part function downstream of G-protein-coupled receptors and play an important role in the formation and maintenance of the neuronal network in the postnatal brain.
Statistics
?
PSSM-Id: 176570
View PSSM: cd08633
Aligned: 3 rows
Threshold Bit Score: 486.855
Threshold Setting Gi: 118101004
Created: 9-Mar-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:catalytic site [active site]
Evidence:
  • Comment:Both prokaryotic and eukaryotic PI-PLCs utilize a similar catalytic mechanism, a general base and acid catalysis involving two well conserved histidines. It consists of two steps, a phosphotransfer and a phosphodiesterase reaction.
  • Comment:Based on structure evidence of the catalytic site in Homo sapiens phospholipase C beta 2.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                      #                                            #                  
O75038     325 HQDMTQPLSHYFITSSHNTYLVGDQLMSQSRVDMYAWVLQAGCRCVEVDCWDGPDGEPIVHHGYTLTSKILFKDVIETIN 404  human
XP_425738  324 NQDMSYPLSHYFITSSHNTYLMGDQLMSQSRVDMYAWVLQSGCRCVEVDCWDGPDGEPIVHHGYTLTSKILFKDVIETIN 403  chicken
CAG07012   311 NQDMTQPLNHYFIATSHNTYLSGDQLLSQSRVEMYAYVLQAGCRCVEVDCWDGPDGEPIIHHGYTLTSKILFKDVIETIN 390  spotted green pu...
Feature 1                                                                                      
O75038     405 KYAFIKNEYPVILSIENHCSVIQQKKMAQYLTDILGDKLDLSSVSsedattLPSPQMLKGKILVKGKKlpanisedaeeg 484  human
XP_425738  404 KYAFIKNEYPVILSIENHCSVVQQKKMAQYLTEILGDKLDLSSVHnddstrLPSPASLKGKILVKGKKlpanisddaeeg 483  chicken
CAG07012   391 KHAFTKSQYPVILSIENHCSVPQQKKMAEYLKEVLQDKLDLSVVIsndckrLPSPEILKGKVLIKVRPrkilvkvnaarv 470  spotted green pu...
Feature 1                                                                                      
O75038     485 evsdedsadeidddckllngdastnrkrventakrkldslikeskirdcedpnnfsvstlsps-----------gklgrk 553  human
XP_425738  484 evsdedsadeidddckimngdastnrkrveniakkkldslikeskirdcedpnnftvttlpssgkagqksdskknkledd 563  chicken
CAG07012   471 tqhsatinpfsrgkncqrasilmqkkvmflmktlgmrkrkmmmtnrqfhprqtdrekentyv-------------lfacl 537  spotted green pu...
Feature 1                                                                                      
O75038     554 skaeedvesgedagasrrngrlvvgsfsrrkkkgsklkkaasveegdegqdspggqsrgatrqkktmkLSRALSDLVKYT 633  human
XP_425738  564 aesgedfstnkrhsrtlmgsfskrkkkgsklkkstsleegeddadsqgnvargsvhytrinrqkktmkLSRALSDLVKYT 643  chicken
CAG07012   538 kggnsvssasstkkkrrfgraimrsfkrkrkkwvqvknkamsdaesnysssrerteivyhpkkrktmrLSRALSDLVKYT 617  spotted green pu...
Feature 1                                                                                      
O75038     634 KSVATHDIEmea-assWQVSSFSETKAHQILQQKPAQYLRFNQQQLSRIYPSSYRVDSSNYNPQPFWNAGCQMVALNYQS 712  human
XP_425738  644 KSVGIHDVEtei-sssWQVSSFSETKAHQILQQKPAQYLRFNQHQLSRIYPSSYRVDSSNYNPQPFWNAGCQLVALNYQS 722  chicken
CAG07012   618 KSVRVHDIEtqaftnsWQVSSLNETVMNQIIQLKPSELVRLNQRQLLRVYPSNYRVDSSNFNPQPYWNTGCHMVALNYQT 697  spotted green pu...
Feature 1                     
O75038     713 EGRMLQLNRAKFSAN 727  human
XP_425738  723 EGRMLQLNRAKFSAN 737  chicken
CAG07012   698 EGRMLELNRAKFSAN 712  spotted green pufferfish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap