Conserved Protein Domain Family
PI-PLCc_eta1

?
cd08632: PI-PLCc_eta1 
Catalytic domain of metazoan phosphoinositide-specific phospholipase C-eta1
This subfamily corresponds to the catalytic domain present in metazoan phosphoinositide-specific phospholipase C (PI-PLC, EC 3.1.4.11)-eta isozyme 1. PI-PLC is a signaling enzyme that hydrolyzes the membrane phospholipids phosphatidylinositol-4,5-bisphosphate (PIP2) to generate two important second messengers in eukaryotic signal transduction cascades, Inositol 1,4,5-trisphosphate (InsP3) and diacylglycerol (DAG). InsP3 triggers inflow of calcium from intracellular stores, while DAG, together with calcium, activates protein kinase C, which then phosphorylates other molecules, leading to altered cellular activity. Calcium is required for the catalysis. PI-PLC-eta represents a class of neuron-speific PI-PLC that has an N-terminal pleckstrin homology (PH) domain, an array of EF hands, a PLC catalytic core domain, a C2 domain, and a unique C-terminal tail that terminates with a PDZ-binding motif, a potential interaction site for other signaling proteins. The PLC catalytic core domain is a TIM barrel with two highly conserved regions (X and Y) split by a highly degenerate linker sequence. PI-PLC-eta1 is a neuron-specific enzyme and expressed in only nerve tissues such as the brain and spinal cord. It may perform a fundamental role in the brain.
Statistics
?
PSSM-Id: 176569
View PSSM: cd08632
Aligned: 3 rows
Threshold Bit Score: 496.089
Threshold Setting Gi: 157886141
Created: 9-Mar-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:catalytic site [active site]
Evidence:
  • Comment:Both prokaryotic and eukaryotic PI-PLCs utilize a similar catalytic mechanism, a general base and acid catalysis involving two well conserved histidines. It consists of two steps, a phosphotransfer and a phosphodiesterase reaction.
  • Comment:Based on structure evidence of the catalytic site in Homo sapiens phospholipase C beta 2.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                      #                                            #                  
EAW78747    89 YQDMDQPLCNYYIASSHNTYLTGDQLLSQSKVDMYARVLQEGCRCVEVDCWDGPDGEPVVHHGYTLTSKILFRDVVETIN 168  human
CAP09295   150 NQDMDQPICNYFIASSHNTYLTGDQLLSHSKTDMYAWVLQAGCRCVEVDCWDGPDGEPMVQHGYTLTSKITFKSVIETIN 229  zebrafish
XP_422832  523 HQDMDQPLCNYFIASSHNTYLTGDQLLSQSRVEMYARVLQDGCRCIEVDCWDGPDGEPVVHHGYTLTSKIFFRDVAETIN 602  chicken
Feature 1                                                                                      
EAW78747   169 KHAFVKNEFPVILSIENHCSIQQQRKIAQYLKGIFGDKLDLSSVDtgeckqLPSPQSLKGKILVKGKKlpyhlgddaeeg 248  human
CAP09295   230 KYAFVNNEFPVILSIENHCSIQQQKKIAQHLKEIFGDKLDVGEALnkdpkqLPSPNLLKGKILLKGKRlpsylsadaeeg 309  zebrafish
XP_422832  603 KYAFIKNEFPVILSIENHCSIQQQKKIAQYLKEILGDKLDLSSVVtgdsrqLPSPQNLKGKILVKGKKlpyslgadaeeg 682  chicken
Feature 1                                                                                      
EAW78747   249 evsdedsadeiedeckfklhysngttehqvesfirkklesllkesqirdkedpdsftvrallkatheglnahlkqspdvk 328  human
CAP09295   310 evsdddsadeieddfklknstsngpsqhqveshirkkldslmkesqigdkedtdsfsiral-----lratheglqrnlrk 384  zebrafish
XP_422832  683 evsdedsadeieddcklkscysngatehqvesfirtklesllkesqirdkedpdsftvrallratheglsvnlkqnldtk 762  chicken
Feature 1                                                                                      
EAW78747   329 esgkkshgrslmtnfgkhkkttksrsksystddeedtqqstgkeggqlyrlgrrrktmkLCRELSDLVVYTNSVAAQDIV 408  human
CAP09295   385 nskdgmkksqsrsfisnlkhkrhsksrlkcqsveteddsqqepsggqfnrggrrrktikLSRDLSDLVVFTNSVASQECL 464  zebrafish
XP_422832  763 eggkkshsrslmgnfgkhkktgkatskcstsdddenqqnssgkeagqlhrltrrrktvkLCRALSDLVVYTNSVAAQDIV 842  chicken
Feature 1                                                                                      
EAW78747   409 ddgttGNVLSFSETRAHQVVQQKSEQFMIYNQKQLTRIYPSAYRIDSSNFNPLPYWNAGCQLVALNYQSEGRMMQLNRAK 488  human
CAP09295   465 degspCNVLSFSEARAQNLVHHRAERFLTFNQRQLSRIYPSAYRIDSSNFNPQTYWNVGCQLVALNYQTEGRMMQLNRAK 544  zebrafish
XP_422832  843 ddgstGNVLSFSETRAHQAVQQKAEQFMLYNQKQLTRVYPSAYRIDSSNFNPLPYWNVGCQLVALNYQSEGRMMQLNEAK 922  chicken
Feature 1          
EAW78747   489 FKAN 492  human
CAP09295   545 FMVN 548  zebrafish
XP_422832  923 FRVN 926  chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap