Conserved Protein Domain Family
PI-PLCc_delta4

?
cd08631: PI-PLCc_delta4 
Catalytic domain of metazoan phosphoinositide-specific phospholipase C-delta4
This subfamily corresponds to the catalytic domain present in metazoan phosphoinositide-specific phospholipase C (PI-PLC, EC 3.1.4.11)-delta4 isozymes. PI-PLC is a signaling enzyme that hydrolyzes the membrane phospholipids phosphatidylinositol-4,5-bisphosphate (PIP2) to generate two important second messengers in eukaryotic signal transduction cascades, Inositol 1,4,5-trisphosphate (InsP3) and diacylglycerol (DAG). InsP3 triggers inflow of calcium from intracellular stores, while DAG, together with calcium, activates protein kinase C, which then phosphorylates other molecules, leading to altered cellular activity. Calcium is required for the catalysis. PLC-delta represents a class of mammalian PI-PLC that has an N-terminal pleckstrin homology (PH) domain, an array of EF hands, a PLC catalytic core domain, and a C-terminal C2 domain. This CD corresponds to the catalytic domain which is a TIM barrel with two highly conserved regions (X and Y) split by a highly degenerate linker sequence. There are three PI-PLC-delta isozymes (1,3 and 4). Unlike PI-PLC-delta 1 and 3, a putative nuclear export sequence (NES) located in the EF-hand domain, which may be responsible transporting PI-PLC-delta1 and 3 from the cell nucleus, is not present in PI-PLC-delta4. Experiments show PI-PLC-delta4 is required for the acrosome reaction in fertilization.
Statistics
?
PSSM-Id: 176568
View PSSM: cd08631
Aligned: 3 rows
Threshold Bit Score: 543.772
Threshold Setting Gi: 74732863
Created: 9-Mar-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:catalytic site [active site]
Evidence:
  • Comment:Both prokaryotic and eukaryotic PI-PLCs utilize a similar catalytic mechanism, a general base and acid catalysis involving two well conserved histidines. It consists of two steps, a phosphotransfer and a phosphodiesterase reaction.
  • Comment:Based on the structure evidence of the catalytic site in Rat Phosphoinositide-specific phospholipase C-Delta1.
  • Citation:PMID 9048554

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                     #                                            #                  
Q9BRC7    289 YQDMTQPLNHYFICSSHNTYLVGDQLCGQSSVEGYIRALKRGCRCVEVDVWDGPSGEPVVYHGHTLTSRILFKDVVATVA 368 human
Q32NH8    289 YQDMMQPLCHYFISSSHNTYLMEDQIRGQSSIEGYIRALKRGCRCVEVDTWDGPNGEPIVYHGRTFTSKILFKDVISAID 368 African clawed frog
CAG06649  346 FQDLGQPLCHYFIASSHNTYLMEDQLRGHSSVEGYIRALSRGCRCVEVDCWDGANGEPIVYHGHTFTSKILFKDVVGAVA 425 spotted green puff...
Feature 1                                                                                     
Q9BRC7    369 QYAFQTSDYPVILSLETHCSWEQQQTMARHLTEILGEQLLSTTLDGvlptqLPSPEELRRKILVKGKKLtleedleyeee 448 human
Q32NH8    369 KYAFRVSDYPVILSLENHCGVEQQDAMAQHLKSILGNKLVMSTLDGripvrLPSPDELRGKILLKGKKIgrledsleeqp 448 African clawed frog
CAG06649  426 NYAFKVSEYPVILSVENHCGVEQQKVMAQHLNHILGDKLLKNTLNGkaptgLPSPEDLRGKILLKAKKIgpledgfngma 505 spotted green puff...
Feature 1                                                                                     
Q9BRC7    449 eaepeleeselalesqfetepepqeqnlqnkdkkkkskpILCPALSSLVIYLKSVSFRSFTHSKEHYhFYEISSFSETKA 528 human
Q32NH8    449 ddslgevsdee-------enieveeernedkkrakkskeRLSQELSDCVIYCKSVPFVSFQHSRAHYiLYEMSSVTEYKA 521 African clawed frog
CAG06649  506 edsqtgevsdend---vvetdednlhpdsvrrrvmrskqRLSKELSDCVVYCKSVHFRSFKHSRIHSkFYEVASFTESKA 582 spotted green puff...
Feature 1                                                                         
Q9BRC7    529 KRLIKEAGNEFVQHNTWQLSRVYPSGLRTDSSNYNPQELWNAGCQMVAMNMQTAGLEMDICDGHFRQN 596 human
Q32NH8    522 RKLVREPGNDFVRHNAWQLMRIYPTGLRTDSSNYNPQDMWNVGCQMTALNFQTAGVEMDLNDGLFRQN 589 African clawed frog
CAG06649  583 RKHLREAGAEFVYHNSRQLTRVYPSGFRTDSSNFNPQEMWNAGCQIVALNFQTAGEGMDLNDGLFRQN 650 spotted green pufferfish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap