Conserved Protein Domain Family
PI-PLCc_gamma1

?
cd08627: PI-PLCc_gamma1 
Catalytic domain of metazoan phosphoinositide-specific phospholipase C-gamma1
This subfamily corresponds to the catalytic domain present in metazoan phosphoinositide-specific phospholipase C (PI-PLC, EC 3.1.4.11)-gamma isozyme 1. PI-PLC is a signaling enzyme that hydrolyzes the membrane phospholipids phosphatidylinositol-4,5-bisphosphate (PIP2) to generate two important second messengers in eukaryotic signal transduction cascades, Inositol 1,4,5-trisphosphate (InsP3) and diacylglycerol (DAG). InsP3 triggers inflow of calcium from intracellular stores, while DAG, together with calcium, activates protein kinase C, which goes on to phosphorylate other molecules, leading to altered cellular activity. Calcium is required for the catalysis. PI-PLC-gamma represents a class of mammalian PI-PLC that has an N-terminal pleckstrin homology (PH) domain, an array of EF hands, a PLC catalytic core domain, and a C2 domain. The PLC catalytic core domain is a TIM barrel with two highly conserved regions (X and Y) split by a highly degenerate linker sequence. Unique to PI-PLC-gamma1, a second PH domain, two SH2 (Src homology 2) regions, and one SH3 (Src homology 3) region is present within this linker region. PI-PLC-gamma1 is ubiquitously expressed. It is activated by receptor and non-receptor tyrosine kinases due to the presence of two SH2 and a single SH3 domain within the linker region.
Statistics
?
PSSM-Id: 176564
View PSSM: cd08627
Aligned: 4 rows
Threshold Bit Score: 347.786
Threshold Setting Gi: 130225
Created: 9-Mar-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:catalytic site [active site]
Evidence:
  • Comment:Both prokaryotic and eukaryotic PI-PLCs utilize a similar catalytic mechanism, a general base and acid catalysis involving two well conserved histidines. It consists of two steps, a phosphotransfer and a phosphodiesterase reaction.
  • Comment:Based on structure evidence of the catalytic site in Homo sapiens phospholipase C beta 2.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                         #                                            #                  
P19174        319 PDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIK 398  human
NP_001082278  312 PQNMDNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSEVLITIK 391  African clawe...
NP_919388     314 PEDMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLNTIK 393  zebrafish
XP_002187212  155 PEEMNHPLSQYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIELDCWDGPDDLPIIYHGHTLTSKIKFLDVLHTIK 234  zebra finch
Feature 1                                                                                         
P19174        399 EHAFVASEYPVILSIEDHCSIAQQRNMAQYFKKVLGDTLLTKPVEiSADGLPSPNQLKRKILIKHKKLaegsayeevpts 478  human
NP_001082278  392 EHAFVTSEYPVILSIEDHCSIAQQRNMAQHFKKVFGDMLLTKPVDvNADGLPSPNQLKRKILIKHKKLaegstyeeipss 471  African clawe...
NP_919388     394 EHAFVTSDYPIILSIEDHCSIVQQRNMATFFKKVFGEMLLTKAVDiSADGLPSPHQLKRKILIKHKKLaegsayeevsss 473  zebrafish
XP_002187212  235 EHAFVTSEFPIILSIEDHCSIVQQRNMACHFKKVFGDMLLTKPVDiNADELPSPTQLKKKILIKHKKLvegnlyeevsta 314  zebra finch
Feature 1                                                                                         
P19174        479 mmysendisnsikngilyledpvnhewyphyfvltsskiyyseetssdqgnedeeepkevssstelhsnekwfhgklgag 558  human
NP_001082278  472 tvysendisnsikngilylqdpinhewyphffvltsskiyyseettssqanddeeeqkeasnsselhsaekwfhgklgag 551  African clawe...
NP_919388     474 tpysendisnsikngilyledpinhewyphffvltsnkiyyseetssnqgnedeeehreicngmdqhvtekwfhgklgag 553  zebrafish
XP_002187212  315 sysendisnsikngilyledpidhtwsphyfvltsnkiyyseetsryqfnedeeeveqkeefnnnelhftekwfhgklgg 394  zebra finch
Feature 1                                                                                         
P19174        559 rdgrhiaerllteycietgapdgsflvresetfvgdytlsfwrngkvqhcrihsrqdagtpkffltdnlvfdslydlith 638  human
NP_001082278  552 rdgrhiaerlltdycietgapdgsflvresetfvgdytlsfwrngkvqhcrihsrqeagspkffltdnlvfeslyalith 631  African clawe...
NP_919388     554 rdgrqiaerllseycvetgapdgsflvresetfvgdytlsfwrsgrvqhcrihsrqeagspkfyltdnlvfdtlfalith 633  zebrafish
XP_002187212  395 grdgrqiaekllheyctetggkdgtflvresetfvgdytlsfwrssrvqhcrihsrqeagatkfyltdnlvfdslyslic 474  zebra finch
Feature 1                                                                                         
P19174        639 yqqvplrcnefemrlsepvpqtnaheskewyhasltraqaehmlmrvprdgaflvrkrnepnsyaisfraegkikhcrvq 718  human
NP_001082278  632 yqqmplrcnefemrltepvpqtnaheskewyhasltrgqaehmlmrvprdgaflvrkrseqnsyaisfraegkikhcrvi 711  African clawe...
NP_919388     634 yqqvplrcnefemkltepvpqtnaheskewyhaclsrsqaenmlmrvprdgaflvrkrtefnsfaisfraegkikhcrvq 713  zebrafish
XP_002187212  475 hyrevplrcnefemrltdpvpqpnaheskewyhasltrlqaehmlmrvprdgaflvrkrsepnsyaisfrk--------- 545  zebra finch
Feature 1                                                                                         
P19174        719 qegqtvmlgnsefdslvdlisyyekhplyrkmklrypineealekigtaepdygalyegrnpgfyveanpmptfkcavka 798  human
NP_001082278  712 qegqsvvlgssefdslvdlisyyekhplyrkmklrypineetlekigtpdpdygalyegrnpgfyveanpmptfkcsvra 791  African clawe...
NP_919388     714 qegqtvvlgtsefdslvdlisyyekhplyrkmklrypineetlekigtaepdygslyegrnpgfyveanqmptfkctvka 793  zebrafish
XP_002187212  546 ---------------ctvkalydykaqredelsfckqaiihnvdkqdggwwrgdyggkkqlwfpanyveeivgtqaqeqd 610  zebra finch
Feature 1                                                                                         
P19174        799 lfdykaqredeltfiksaiiqnvekqeggwwrgdyggkkqlwfpsnyveemvnpvaleperehldensplgdllrgvldv 878  human
NP_001082278  792 lfdykaqredeltftkntiiqnvekqeggwwrgdcggkkqmwfpanyveeifspaepeperqnldensplgdllggvldv 871  African clawe...
NP_919388     794 myeykaqrddelsfiknaiisnvdkqeggwwkgdcggkkqlwfpanyveeisptavepdrsasensplgdllrgsvdvss 873  zebrafish
XP_002187212  611 eassensplgnflkgfidvpschvviskdgrsskpfvftihsqqmshaaqsldvaadtqeelsewvakireatqnadarm 690  zebra finch
Feature 1                                                                                         
P19174        879 pacqiairpegknnrlfvfsismasvahwsldvaadsqeelqdwvkkirevaqtadarltegkimerrkkialelselvv 958  human
NP_001082278  872 pschiaprqdvhngrpfvftitgpqlnrypldvaadtledmqdwirkireaaqtadarltegkimerrkkialelselvi 951  African clawe...
NP_919388     874 cqivvrpegkgsrqfvfslvpvasprtgpvldiaassqeelkdwvvkirevtmtseakleegkmmerrkkialelsdlvi 953  zebrafish
XP_002187212  691 qegkimerrkkialelselvvyxyrdmssfpetkaekyanrskgkkflqynrrqlsriypkgqrldssnydplpmwicgs 770  zebra finch
Feature 1                                                                                         
P19174        959 ycrpvpfdeekigteracYRDMSSFPETKAEKYVNKaKGKKFLQYNRLQLSRIYPKGQRLDSSNYDPLPMWICGSQLVAL 1038 human
NP_001082278  952 ycrpvpfdeekigtekacYRDMSSFPETKAEKYVNKmKGKKFLQYNRRQLSRIYPKGQRLDSSNYDPLTMWICGSQLVAL 1031 African clawe...
NP_919388     954 ycrpvpfdedkigteracFRDMSSFPETKAEKYVNRvKGKKFLQYNRLQLSRIYPRGQRLDSSNYDPLPMWLCGSQLVAL 1033 zebrafish
XP_002187212  771 qlvalnfqtpeigtdkacYRDMSSFPETKAEKYANRsKGKKFLQYNRRQLSRIYPKGQRLDSSNYDPLPMWICGSQLVAL 850  zebra finch
Feature 1                            
P19174       1039 NFQTpDKPMQMNQALFMTG 1057 human
NP_001082278 1032 NFQTpDKPMQMNQALFQSG 1050 African clawed frog
NP_919388    1034 NFQTaDKPMQMNQAIFMLN 1052 zebrafish
XP_002187212  851 NFQTpDKPMQLNQALFMLG 869  zebra finch

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap