Conserved Protein Domain Family
PI-PLCc_beta4

?
cd08626: PI-PLCc_beta4 
Catalytic domain of metazoan phosphoinositide-specific phospholipase C-beta4
This subfamily corresponds to the catalytic domain present in metazoan phosphoinositide-specific phospholipase C (PI-PLC, EC 3.1.4.11)-beta isozyme 4. PI-PLC is a signaling enzyme that hydrolyzes the membrane phospholipids phosphatidylinositol-4,5-bisphosphate (PIP2) to generate two important second messengers in eukaryotic signal transduction cascades, Inositol 1,4,5-trisphosphate (InsP3) and diacylglycerol (DAG). InsP3 triggers inflow of calcium from intracellular stores, while DAG, together with calcium, activates protein kinase C, which goes on to phosphorylate other molecules, leading to altered cellular activity. Calcium is required for the catalysis. PLC-beta represents a class of mammalian PI-PLC that has an N-terminal pleckstrin homology (PH) domain, an array of EF hands, a PLC catalytic core domain, a C2 domain, and a unique C-terminal coiled-coil (CT) domain necessary for homodimerization. The PLC catalytic core domain is a TIM barrel with two highly conserved regions (X and Y) split by a highly degenerate linker sequence. PI-PLC-beta4 is expressed in high concentrations in cerebellar Purkinje and granule cells, the median geniculate body, and the lateral geniculate nucleus. It is activated by the heterotrimeric G protein alpha q subunits through their C2 domain and long C-terminal extension.
Statistics
?
PSSM-Id: 176563
View PSSM: cd08626
Aligned: 12 rows
Threshold Bit Score: 305.921
Threshold Setting Gi: 4521177
Created: 9-Mar-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:catalytic site [active site]
Evidence:
  • Comment:Both prokaryotic and eukaryotic PI-PLCs utilize a similar catalytic mechanism, a general base and acid catalysis involving two well conserved histidines. It consists of two steps, a phosphotransfer and a phosphodiesterase reaction.
  • Comment:Based on structure evidence of catalytic site in Homo sapiens phospholipase C beta 2.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                         #                                               #               
NP_001166117  312 YQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGkge-dqEPIITHGKAMCTDILFKDVIQ 390  human
AAS55894      315 YQDMEQPLSHYFINSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGrse-dqEPIITHGLAMCTDIQFRDVIQ 393  painted urchin
ABJ96343      309 YQDLDQPLSHYYINSSHNTYLSGRQFGGKSSVEMYRQVLLAGCRCIELDCWDGkge-dqEPIITHGKAMCSDVLFKDVIR 387  Chaetopterus ...
AAL77168      339 FMDMDQPLCHYYINSSHNTYLTGRQYGGKSSSEIYRQVLLSGCRCIELDCWDGtgenkgEPIITHGKAMCTDVFFKDVLV 418  Caenorhabditi...
XP_002117861  279 AKDMDEPIAHYFINSSHNTYLVGKQFGGKSVVDMYRNVLLAGCRCIELDCWDGkgq-deEPIITHGKAMCSDILFKDVIE 357  Trichoplax ad...
XP_002119560  302 HADMEQPLSHYFINSSHNTYLTGFQIRGKSSVDIYRHILLSGCRCIELDCWDGkgelhgEPIITHGKAMCTDVLFKNVLV 381  Ciona intesti...
EEC02277      312 YMDMDQPLSHYYINSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGkge-deEPIITHGKAMCTDILFKDVIY 390  Ixodes scapul...
XP_002610542  288 YQDMDQPLCHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLAGCRCVELDCWDGkge-dqEPIITHGKAMCTDVLFKDVIH 366  Florida lancelet
P13217        318 YMEMDQPLAHYYINSSHNTYLSGRQIGGKSSVEMYRQTLLAGCRCVELDCWNGkge-deEPIVTHGHAYCTEILFKDCIQ 396  Drosophila me...
XP_001231684  312 YQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGkge-dqEPIITHGKAMCTDILFKDVIQ 390  chicken
AAI53326      312 YQEMEHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGkge-dqEPIITHGKAMCTDILFKDVIQ 390  western clawe...
BAA76277      311 RHDMNQPINHYFINSSHNTYLLGRQVYGKSSVEIYRQVLISGCRCIELDCWDGp----gVPIITHGKAMCTNVLFSDVVQ 386  green hydra
Feature 1                                                                                         
NP_001166117  391 AIKETAFVTSEYPVILSFENHCSkyQQYKMSKYCEDLFGDLLLKQALESHPLEPGraLPSPNDLKRKILIKNKRlkpeve 470  human
AAS55894      394 AIRDTAFVTSDFPVILSFENHCSkpQQLKLARYCEEVLGEFLLTEKLDDHPLDASvpLPSPNKLKRKILIKNKRlkpeve 473  painted urchin
ABJ96343      388 AIKDTAFVTSDYPVILSFENHCSklQQYKLAKYCEETFGDLLLTKPLDSHVLEPGaaLPSPNLLKRKILIKNKRlkpdve 467  Chaetopterus ...
AAL77168      419 QIRDTAFARSDFPVVLSFENHCSksNQLKMAKYCMDIFGDMLLSKPFEDAPLDPGvsLPSPNRLRKKILIKNKRlktdie 498  Caenorhabditi...
XP_002117861  358 VIKEAAFIATDYPVILSFENHCSikQQRKLAQYCLESFGDLLLTKPIDGYPTEPGkrLPPPSKLRGKILIKNKKlikteq 437  Trichoplax ad...
XP_002119560  382 AIRDAAFVTSQYPVILSFETHCSkpLQHKMAMYCREIFGEMLLDRNLESHPLLPGqpLPSPHQLQRKILIKNKRlqpdve 461  Ciona intesti...
EEC02277      391 AIRDCAFVTSDYPVILSFENHCCkkQQYKLAKYCSEIFGDLLLTEPLPSYPLEPCvsLPTPNELKRKILIKNKRlkpede 470  Ixodes scapul...
XP_002610542  367 AIAETAFEASDYPVILSFENHCCkaQQYKLAKYCDEIFGDLLLKEPLEDYVLEEGkdLPPPNALKRKILIKNKRlkpeme 446  Florida lancelet
P13217        397 AIADCAFVSSEYPVILSFENHCNraQQYKLAKYCDDFFGDLLLKEPLPDHPLDPGlpLPPPCKLKRKILIKNKRmkpeve 476  Drosophila me...
XP_001231684  391 AIKETAFVTSEYPVILSFENHCSkyQQYKMSKYCEDLFGDLLLKQPLETHPLDPGkaLPSPNDLKRKILIKNKRlkpeve 470  chicken
AAI53326      391 AIKDTAFVTSEYPVILSFENHCSkyQQYKMSKYCEEIFGDLLLSKALESHPLDTGrpLPSPNDLKRKILIKNKRlkaeve 470  western clawe...
BAA76277      387 AIADTAFLTSPYPVVLSFENHCSlpQQKILAEMCIKIFGPLLLDKPLESNPLEPGieLPSPEQLKYKILIKNKKlasnde 466  green hydra
Feature 1                                                                                         
NP_001166117  471 kkqlealrsmmeagesaspanileddneeeiesadqeeeahpefkfgnel------------------------------ 520  human
AAS55894      474 qrqlelmrlrpellevnqedeveecesgysdgavsppgntdahpkfkfpskd---------------------------- 525  painted urchin
ABJ96343      468 krqmelfmkgqtraimednepvedadatvivegeesannedpaka----------------------------------- 512  Chaetopterus ...
AAL77168      499 rhqldqflregkldeedelnetpevvgedsvsprsggsggtgapeevdddtsdddddpsvqtslnvmrtiptvnttsnng 578  Caenorhabditi...
XP_002117861  438 dtekenaaaskdtansptkdsngtittnsqngiksdsaasdtkkdgt--------------------------------- 484  Trichoplax ad...
XP_002119560  462 kaqledlksdsvtwgdddvtdetleeahpelqstkscddtklnissqscmsdi--------------------------- 514  Ciona intesti...
EEC02277      471 krelelwkkgqlqndddeeekedasvtilapteegegekkvss------------------------------------- 513  Ixodes scapul...
XP_002610542  447 kkqlelfwkgegnleveeeehsesecfllsgengvsspsedgnpqe---------------------------------- 492  Florida lancelet
P13217        477 kvelelwlkgelktdddpeedasagkppeaaaap---------------------------------------------- 510  Drosophila me...
XP_001231684  471 kkqldalkkmmeagetaapvnileddneeeiesadqeeeahpey------------------------------------ 514  chicken
AAI53326      471 kkqlealksmmeagetatpvsileddieeeienadqeeeahpefkfgsel------------------------------ 520  western clawe...
BAA76277      467 mqfsngklnssanisydipvempetntssysscdvpdlesesemehdncfneddlsrmvtednfetklnekmdqfakqvy 546  green hydra
Feature 1                                                                                         
NP_001166117      --------------------------------------------------------------------------------      human
AAS55894          --------------------------------------------------------------------------------      painted urchin
ABJ96343          --------------------------------------------------------------------------------      Chaetopterus ...
AAL77168      579 snrsarssldtpspsggslmvpdratstatsiknavlarspnfsslrqklsfkrrqsplagdqrahpeveqpvsssspat 658  Caenorhabditi...
XP_002117861      --------------------------------------------------------------------------------      Trichoplax ad...
XP_002119560      --------------------------------------------------------------------------------      Ciona intesti...
EEC02277          --------------------------------------------------------------------------------      Ixodes scapul...
XP_002610542      --------------------------------------------------------------------------------      Florida lancelet
P13217            --------------------------------------------------------------------------------      Drosophila me...
XP_001231684      --------------------------------------------------------------------------------      chicken
AAI53326          --------------------------------------------------------------------------------      western clawe...
BAA76277      547 sesssnnqpvmrrrstqefnlkkyklski-----------------------------------aencvvddsedeiilt 591  green hydra
Feature 1                                                                                         
NP_001166117  521 -------------------------------------------saddlghkeavansvkkasddlehennkkglvtvede 557  human
AAS55894      526 -----------------------------------------sigsisgssiaaedeiklkhnmsvkmnakkgellsqede 564  painted urchin
ABJ96343      513 ------------------------------------------------tpgtaingptvngpalddndahpegmltadee 544  Chaetopterus ...
AAL77168      659 psisgpppcatssgstssititttgcstsssgpskhilggempakendeahpelkqnfiaknlkgfgfskkqpvltkeee 738  Caenorhabditi...
XP_002117861  485 ----------------------------------------------ddakpkingstttkttkgdssedppakknldpdv 518  Trichoplax ad...
XP_002119560  515 -----------------------------------------svesniekgllkplvatksndstkkssirkpvdgdvead 553  Ciona intesti...
EEC02277      514 --------------------------------------------------prdgrgwstrystltrsadgavqveaqlee 543  Ixodes scapul...
XP_002610542  493 -----------------------------------------------fkfnksnsssdiqeegkngslknkkvemleeeq 525  Florida lancelet
P13217        511 ------------------------------------------------------------apapeaaaaaegaaegggga 530  Drosophila me...
XP_001231684  515 -------------------------------------------------kfgsdltvddysqkeavaisvkkglvtvede 545  chicken
AAI53326      521 -------------------------------------------ssddlsqkeaaniakkmaedaeqennnkkgaitvede 557  western clawe...
BAA76277      592 kfgsnpciasalneevnsntttsvlecednsshfpskwrshsvaplnqseteavdikrraisdisdietskkvssmstvm 671  green hydra
Feature 1                                                                                         
NP_001166117  558 qawmasykyvgattnihpyLSTMINYAQPVKFQGFHVAEERNihYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPK 637  human
AAS55894      565 aavvaqyrytgattnihacLSRLVNYAQPVKFQGFDVAEERNlhFNMSSFNESVGLGYIKTQCIEFVNYNKRQMSRIYPQ 644  painted urchin
ABJ96343      545 aalltsyhytgattnihpvLSSMVNYAQPVKFQGFDVAEEVNcmFHMSSFNEGAALGLVKNTVIELVHYNKRQLSRIYPK 624  Chaetopterus ...
AAL77168      739 erifaeyhytgattnihplLSSLVNYTHPVKFSGFDVAEANNlhFHMSSFSESTGLGYLKQSAPEFVNYNKRQSSRIYPK 818  Caenorhabditi...
XP_002117861  519 vaavanyrytgstgnidelLSSVVIYTQPVPFPGFEEAKQRNlhYNMSSFNESTGFGHFKASPTDYVNYNKRQLSRIYPK 598  Trichoplax ad...
XP_002119560  554 lmlvyyayqktsatnihpsLSVLVNYCQSVKFPGFKKVQEKCc-FHMSSFSENGGMNYIKSNAVNLTNYNKSQLSRIYPR 632  Ciona intesti...
EEC02277      544 qlamahyqytgatvhvhpfLSSLVNYAQPVKFQGFDVAEERSvhFNMSSFAETSALGYLKSQAIEFVNYNKRQLSRIYPK 623  Ixodes scapul...
XP_002610542  526 amamaqyqyqgattnvhpwLSSMVNYAQPVKFAGFDVAEDRNihHNMSSFNESACLGYLKTSAIEFVNYNKRQMSRIYPK 605  Florida lancelet
P13217        531 eaeaaaanysgsttnvhpwLSSMVNYAQPIKFQGFDKAIEKNiaHNMSSFAESAGMNYLKQSSIDFVNYNKRQMSRIYPK 610  Drosophila me...
XP_001231684  546 qawmasykyvgattnihpyLSTMVNYAQPVKFQGFDVAEERNihHNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPK 625  chicken
AAI53326      558 qawmasykyvgattnihpfLSSMINYAQPVKFQGFKVAEERNihFNMSSFNESVGLGYLKTHALEFVNYNKRQMSRIYPK 637  western clawe...
BAA76277      672 snlpdnsiitsvsgkvdplLSSLINYVQPQSFKGFEYAEEQKkhYIMSSFSELEGLKQCTENLTDFVLYNKRQFSRIYPK 751  green hydra
Feature 1                                                    
NP_001166117  638 GGRVDSSNYMPQIFWNAGCQMVSLNYQTpDLAMQLNQGKFEYN 680  human
AAS55894      645 GRRYDSSNYMPQIFWNAGCQMVALNFQSpDIGMQLNQGKFEYN 687  painted urchin
ABJ96343      625 GARVDSSNYMPQIFWNAGCQMVSLNFQTpDLAMQLNQGKFEYN 667  Chaetopterus variopedatus
AAL77168      819 GARVDSSNFLPQIFWNAGCQMVSLNFQTpDVYMQLNMGKFEYN 861  Caenorhabditis elegans
XP_002117861  599 GSRVESSNFIPQIFWNAGSQMVSLNFQTpDLGFQLNQCKFEYN 641  Trichoplax adhaerens
XP_002119560  633 GNRVDSSNYMPQIFWNVGCQLVSLNYQTsDLGMQLNLAKFEYN 675  Ciona intestinalis
EEC02277      624 GTRADSSNFLPQIFWNAGCQMVALNFQTpDLPMQLNQGKFEYN 666  Ixodes scapularis
XP_002610542  606 GARVDSSNYMPQIFWNAGCQMVALNYQTpDLSMQLNQGKFEYN 648  Florida lancelet
P13217        611 GTRADSSNYMPQVFWNAGCQMVSLNFQSsDLPMQLNQGKFEYN 653  Drosophila melanogaster
XP_001231684  626 GGRVDSSNYMPQIFWNAGCQMVSLNYQTpDLAMQLNQGKFEYN 668  chicken
AAI53326      638 GGRVDSSNYMPQIFWNAGCQMVSLNYQTpDLAMQLNQGKFEYN 680  western clawed frog
BAA76277      752 ATRVESTNYVPQVFWNAGCQFVALNLQTpDLSVQLNQQKFECN 794  green hydra

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap