Conserved Protein Domain Family
PI-PLCc_beta3

?
cd08625: PI-PLCc_beta3 
Catalytic domain of metazoan phosphoinositide-specific phospholipase C-beta3
This subfamily corresponds to the catalytic domain present in metazoan phosphoinositide-specific phospholipase C (PI-PLC, EC 3.1.4.11)-beta isozyme 3. PI-PLC is a signaling enzyme that hydrolyzes the membrane phospholipids phosphatidylinositol-4,5-bisphosphate (PIP2) to generate two important second messengers in eukaryotic signal transduction cascades, Inositol 1,4,5-trisphosphate (InsP3) and diacylglycerol (DAG). InsP3 triggers inflow of calcium from intracellular stores, while DAG, together with calcium, activates protein kinase C, which goes on to phosphorylate other molecules, leading to altered cellular activity. Calcium is required for the catalysis. PLC-beta represents a class of mammalian PI-PLC that has an N-terminal pleckstrin homology (PH) domain, an array of EF hands, a PLC catalytic core domain, a C2 domain, and a unique C-terminal coiled-coil (CT) domain necessary for homodimerization. The PLC catalytic core domain is a TIM barrel with two highly conserved regions (X and Y) split by a highly degenerate linker sequence. PI-PLC-beta3 is widely expressed at highest levels in brain, liver, and parotid gland. It is activated by the heterotrimeric G protein alpha q subunits through their C2 domain and long C-terminal extension. It is also activated by the beta-gamma subunits of heterotrimeric G proteins.
Statistics
?
PSSM-Id: 176562
View PSSM: cd08625
Aligned: 3 rows
Threshold Bit Score: 528.086
Threshold Setting Gi: 119594637
Created: 9-Mar-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:catalytic site [active site]
Evidence:
  • Comment:Both prokaryotic and eukaryotic PI-PLCs utilize a similar catalytic mechanism, a general base and acid catalysis involving two well conserved histidines. It consists of two steps, a phosphotransfer and a phosphodiesterase reaction.
  • Comment:Based on structure evidence of catalytic site in Homo sapiens phospholipase C beta 2.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                         #                                              #                
EAW74231      249 STDMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRCVELDVWKGRPpEEEPFITHGFTMTTEVPLRDVLEA 328  human
NP_001081169  316 SDDMNQPLSSYFINSSHNTYLTAGQLTGNSSVEMYRQVLLTGCRCIELDCWKGRPqDEEPFITHGFTMTTEIPFKEVIEA 395  African clawe...
NP_001116245  317 IDDMNQPLSHYFINSSHNTYLTVGQLTGLSSVEMYRQVLLTGCRCIELDCWKGRPpEEEPIITHGFTMTTEIPFKDVIEA 396  Danio rerio
Feature 1                                                                                         
EAW74231      329 IAETAFKTSPYPVILSFENHVDSaKQQAKMAEYCRSIFGDALLIEPLDKYPLAPGvpLPSPQDLMGRILVKNKKrhrpsa 408  human
NP_001081169  396 IAESAFKTSPFPVILSFENHVDSsKQQAKMAEYCRNIFGDALLIDPLEKYPLQPGvaLPSPQELMGKILVKNKKrhkvav 475  African clawe...
NP_001116245  397 IAESAFKTSPYPLILSFENHVDSaKQQAKMAEYCRSMFGDALLIDPLDKYPLVPGqqLPSPQELLGKILIKNKKkhhhra 476  Danio rerio
Feature 1                                                                                         
EAW74231      409 ggpdsagrkrpleqsnsalsessaatepsspqlgspssdscpglsngeevglekpslepqkslgdeglnrgpyvlgpadr 488  human
NP_001081169  476 kgpegsvkrrvseqtsntysdsssvcessatglppsesadvsltlsn--------------gdekieekppkytkprksi 541  African clawe...
NP_001116245  477 snggsirrkdgtdeqssplndcplsdgdvgqlmsnggeklaerm---------------------akdhdnsksidrgdg 535  Danio rerio
Feature 1                                                                                         
EAW74231      489 edeeedeeeeeqtdpkkpttdegtassevnateeMSTLVNYIEPVKFKSFEAARKRNKcFEMSSFVETKAMEQLTKSPME 568  human
NP_001081169  542 dhdayseeeeeeepsdpkksdegtassevnateeMSTLVNYVEPVKFKSFDAAKKRNKyYEMSSFVETKALEQLTKSPME 621  African clawe...
NP_001116245  536 esdeeeeeepipdpkkhnntdegtaysevnateeMSTLVNYIEPVKFKSFEVAAKRKKfFEMSSFVETKGMDTLKNSPTE 615  Danio rerio
Feature 1                                                                   
EAW74231      569 FVEYNKQQLSRIYPKGTRVDSSNYMPQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYN 626  human
NP_001081169  622 FVEYNKKQLSRIYPKGTRVDSSNYMPQLFWNAGCQMVALNFQTLDLPMQLNVGIFEYN 679  African clawed frog
NP_001116245  616 FVEYNKKQMSRIYPKGTRVDSSNYMPQLFWNVGCQMVALNFQTLDLAMQLNMGVFEYN 673  Danio rerio

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap