Conserved Protein Domain Family
PI-PLCc_beta1

?
cd08623: PI-PLCc_beta1 
Catalytic domain of metazoan phosphoinositide-specific phospholipase C-beta1
This subfamily corresponds to the catalytic domain present in metazoan phosphoinositide-specific phospholipase C (PI-PLC, EC 3.1.4.11)-beta isozyme 1. PI-PLC is a signaling enzyme that hydrolyzes the membrane phospholipids phosphatidylinositol-4,5-bisphosphate (PIP2) to generate two important second messengers in eukaryotic signal transduction cascades, Inositol 1,4,5-trisphosphate (InsP3) and diacylglycerol (DAG). InsP3 triggers inflow of calcium from intracellular stores, while DAG, together with calcium, activates protein kinase C, which goes on to phosphorylate other molecules, leading to altered cellular activity. Calcium is required for the catalysis. PLC-beta represents a class of mammalian PI-PLC that has an N-terminal pleckstrin homology (PH) domain, an array of EF hands, a PLC catalytic core domain, a C2 domain, and a unique C-terminal coiled-coil (CT) domain necessary for homodimerization. The PLC catalytic core domain is a TIM barrel with two highly conserved regions (X and Y) split by a highly degenerate linker sequence. PI-PLC-beta1 is expressed at highest levels in specific regions of the brain. It is activated by the heterotrimeric G protein alpha q subunits through their C2 domain and long C-terminal extension.
Statistics
?
PSSM-Id: 176560
View PSSM: cd08623
Aligned: 3 rows
Threshold Bit Score: 486.513
Threshold Setting Gi: 208342308
Created: 9-Mar-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:catalytic site [active site]
Evidence:
  • Comment:Both prokaryotic and eukaryotic PI-PLCs utilize a similar catalytic mechanism, a general base and acid catalysis involving two well conserved histidines. It consists of two steps, a phosphotransfer and a phosphodiesterase reaction.
  • Comment:Based on structure evidence of the catalytic site in Homo sapiens phospholipase C beta 2.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                      #                                              #                
Q9Z1B3     315 NEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCVELDCWKGRTaEEEPVITHGFTMTTEISFKEVIEA 394  house mouse
ACI25594   316 SEDMTFPLSHYFINSSHNTYLTAGQLAGNSSVEMYKQVLLSGCRCIELDCWKGRTtEEEPVTTHGFTMTTEISFKEVIEA 395  Japanese flounder
XP_425261  515 NEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCVELDCWKGRTaEEEPVITHGFTMTTEISFKEVIEA 594  chicken
Feature 1                                                                                      
Q9Z1B3     395 IAECAFKTSPFPILLSFENHVDSPKQQAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKkshkss 474  house mouse
ACI25594   396 IAECAFKTSPFPIILSFENHVDSPKQQAKMAEYCRSIFGDALLTEPLERYPLESGVPLPCPMELMGKVLVKNKKkhhktn 475  Japanese flounder
XP_425261  595 IAECAFKTSPFPILLSFENHVDSPKQQAKMAEYCRLIFGDALLMDPLEKYPLEPGVPLPSPMDLMYKILVKNKKkshksa 674  chicken
Feature 1                                                                                      
Q9Z1B3     475 egsgkkklseqasntysdsssvfepsspga-----------------------------geadtesddddddddckkssm 525  house mouse
ACI25594   476 gstkkklseqvsntysdsssvcepsspsagstkdemadssqpsegaelslrpqgrksigevgaesededdddddckkgsm 555  Japanese flounder
XP_425261  675 dgsakkklseqasntcsdtssmfepsspga----------------------------geaeiesdddddydddckkssm 726  chicken
Feature 1                                                                                      
Q9Z1B3     526 degtagseamateeMSNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPKGTRVD 605  house mouse
ACI25594   556 degtagseafateeMSNLVIYTQPVKFNSFEASKKINRSYQMSSFVETKALEQLTKSPVEFVEYNKLQLSRIYPKGTRVD 635  Japanese flounder
XP_425261  727 degtagseamateeMSNLVNYIQPVKFESFEVSKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPKGTRVD 806  chicken
Feature 1                                            
Q9Z1B3     606 SSNYMPQLFWNAGCQMMALNFQTVDLAMQINMGMYEYN 643  house mouse
ACI25594   636 SSNYNPQLFWNAGCQLVALNFQTIDLSMQLNLGMYEYN 673  Japanese flounder
XP_425261  807 SSNYMPQVFWNAGCQMVALNFQTVDLSMQINMGMYEYN 844  chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap