Conserved Protein Domain Family
GDPD_GDE6

?
cd08610: GDPD_GDE6 
Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE6 and similar proteins
This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in mammalian GDE6 (also known as glycerophosphodiester phosphodiesterase domain-containing protein 4 (GDPD4)) and their metazoan homologs. Mammalian GDE6 is a transmembrane protein predominantly expressed in the spermatocytes of testis. Although the specific physiological function of mammalian GDE6 has not been elucidated, its different pattern of tissue distribution suggests it might play a critical role in the completion of meiosis during male germ cell differentiation.
Statistics
?
PSSM-Id: 176552
View PSSM: cd08610
Aligned: 3 rows
Threshold Bit Score: 593.774
Threshold Setting Gi: 74710342
Created: 9-Dec-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:catalytic site [active site]
Evidence:
  • Comment:The catalytic mechanism of glycerophosphodiester phosphodiesterases is based on the metal ion-dependent general acid-base reaction.
  • Comment:Based on structure evidence and site-directed mutagenesis of Thermoanaerobacter tengcongensis glycerophosphodiester phosphodiesterase, the catalytic site consists of two conserved histidine residues which serve as general acid and general base in catalyzing the hydrolysis of the 3'-5' phosphodiester bond.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                   #                                         #          
Q6W3E5       176 LYLMPLGIYSPCIQEKenLGPKPTIFGHRGAPMLGPENTMMSFEKAVEHGAHGLETDIHLSYDHVPFLMHDFDLKRTTNI 255 human
XP_001377892 278 IYTIPLGISSPCIRENktLARKPTFIGHRGAPMLAPENTQMSFEKAIEHGATGLETDVTLSYDGVPFLMHDYTLRRTTNI 357 gray short-tail...
XP_417276    228 LFLIPLGMYSPCIREVgtLGPKPALIGHRGAPMLAPENTEMSFQKTIEHGADGLETDVTISYDGVPFLMHDSTLSRTTNI 307 chicken
Feature 1                                                                                        
Q6W3E5       256 GEVQPESAcENPAFFNWDFLSTLNAGKWFVKpelRPFYNMKPLSEADKeRARNQSIPTLADLLTLAeKERKFVIFDLHRP 335 human
XP_001377892 358 HEIMPTSShLPSSMFTWQTLETLNSGQWFFKa--QPFKFMEPLTKEDElKAKNQSVMKLSNFLRLAnRENKLVIFDLYRP 435 gray short-tail...
XP_417276    308 KEVYPNDTaQNAALFSWDALKELNAGAWFLKd--KPFSCMGSLSRADQnQAMNQSIYKLSNFLRLAdSQNKLVIFDLYRP 385 chicken
Feature 1                                                                                        
Q6W3E5       336 PPkHPLRHTFVRQVVSVILAS-KIEQHLIFWLPAHDrqYVRSVAPGF-QHVGRLVSIETLAKNNISIINVDYKKLfpngL 413 human
XP_001377892 436 PKkHPYRDKWIIRVLEVILNEvGMKSHLVLWLPGQFraDVQMMAPDFkQVLGTKLPLSELLRMKINGLNLAYKDIdskdI 515 gray short-tail...
XP_417276    386 PEkHPYRNSWINRTLEVILNEsGIRPHLVLWLENDMrsFVQSVAPGFqQTMGSKAPVEDLLTDNIVKLNLAYTEMssedI 465 chicken
Feature 1                                                                                      
Q6W3E5       414 RDYKAANIHINVYTVNEPWLFSLAWCSRINSVTTDNIGLLSQLDHPHFFMTPKFYVFMWLLADIISVLFIVAIFCFHW 491 human
XP_001377892 516 KEFEKYGIFTNIYVINEPWLYSLAWCAGVHSVTTNTIHILKKIKRPFFFMTPKEYMLKWLLLDFISAIVIVLVFFYHW 593 gray short-tailed...
XP_417276    466 RKYAEANITTNFYVINEPWLFSLAWCSGAHSVTTNAVHTLKNLSQPLFLMTPRQYNIMWILTDLASVLLISLIFALHW 543 chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap