Conserved Protein Domain Family
PI-PLCc_plant

?
cd08599: PI-PLCc_plant 
Catalytic domain of plant phosphatidylinositide-specific phospholipases C
This family corresponds to the catalytic domain present in a group of phosphoinositide-specific phospholipases C (PI-PLC, EC 3.1.4.11) encoded by PLC genes from higher plants, which are homologs of mammalian PI-PLC in terms of overall sequence similarity and domain organization. Mammalian PI-PLC is a signaling enzyme that hydrolyzes the membrane phospholipids phosphatidylinositol-4,5-bisphosphate (PIP2) to generate two important second messengers in eukaryotic signal transduction cascades, inositol 1,4,5-trisphosphate (InsP3) and diacylglycerol (DAG). InsP3 triggers inflow of calcium from intracellular stores, while DAG, together with calcium, activates protein kinase C, which then phosphorylates other molecules, leading to altered cellular activity. Calcium is required for the catalysis. The domain arrangement of plant PI-PLCs is structurally similar to the mammalian PLC-zeta isoform, which lacks the N-terminal pleckstrin homology (PH) domain, but contains EF-hand like motifs (which are absent in a few plant PLCs), a PLC catalytic core domain with X- and Y- highly conserved regions split by a linker sequence, and a C2 domain. However, at the sequence level, the plant PI-PLCs are closely related to the mammalian PLC-delta isoform. Experiments show that plant PLCs display calcium dependent PLC catalytic properties, although they lack some of the N-terminal motifs found in their mammalian counterparts. A putative calcium binding site may be located at the region spanning the X- and Y- domains.
Statistics
?
PSSM-Id: 176541
View PSSM: cd08599
Aligned: 9 rows
Threshold Bit Score: 349.748
Threshold Setting Gi: 116059156
Created: 30-Sep-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:catalytic site [active site]
Evidence:
  • Comment:Both prokaryotic and eukaryotic PI-PLCs utilize a similar catalytic mechanism, a general base and acid catalysis involving two well conserved histidines. It consists of two steps, a phosphotransfer and a phosphodiesterase reaction.
  • Comment:Based on structure evidence of the catalytic site in Homo sapiens phospholipase C beta 2.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                        #                                                     #         
Q944C1       113 HQNMDAPLSHYFIFTGHNSYLTGNQLSSNCSeLPIADALRRGVRVVELDLWPRgt---------ddVCVKHGRTLTkeVK 183 thale cress
ABR16641     106 HHDMTAPLSHYFIYTGHNSYLTGNQLSSDCSdAPIIKALNRGVRVIELDIWPNsak--------ddVLVLHGRTLTspVE 177 Sitka spruce
BAD02919     105 HQDMTQPLSHYFIFTGHNSYLTGNQLSSDSSdVPIAAALQRGVRVVELDLWPDdk---------ggIKVTHGNTLTspVA 175 Physcomitrella ...
XP_001766820 125 THDMTRPLSHYYIYASHNSYLTGNQLTSSSSiVPIIEALRNGCRVIELDCWEKqgqqcwsgstnndIVVLHGNTLTsaIP 204 Physcomitrella ...
BAD02928     147 TDDMNAPLSDYYIFSSHNTYLMGNQLCSPSStAPIVKALLDGCRVIELDCWNGsn---------krIDVLHGGTLTkaVP 217 Physcomitrella ...
EEH59920     110 VSSMNEPLSHYFINSSHNTYLSGDQLFSRSLtFAIKRALLHGCRVIELDCYDGgr---------egPVVMHGITATqsIT 180 Micromonas pusi...
CAL54863     116 ESEMTSEMSAYFVNSSHNTYLDGDQLFSRASvAAIAGALDRGCRVIELDVYDGkkrg-----dkprPIVTHGGTAVrpMY 190 Ostreococcus tauri
Q9STZ3       104 HHDMHAPLSHYFIHTSLNSYFTGNVFGKYSI-LPIIEALEQGVRVVELDLWPDgr---------gsICVRPSWNFEkpLK 173 thale cress
XP_001696502  31 YQDMKQPLSHYFVSSGHNSYLTGNQLTSASGtATIIACLQGSCRVIELDVYNG-------------PECKHGGTLTkaIS 97  Chlamydomonas r...
Feature 1                                                                                        
Q944C1       184 LGKCLESIKANAFAISKYPVIITLEDHLTpkLQFKVAKMITQTFGDMLYYHDSQgc----qeFPSPEELKEKILISTKPP 259 thale cress
ABR16641     178 FIKCIRSIKEHAFVASQYPVIITLEDHLTrdLQAKAAETITKTFGELLYYPKSEvl----eeFPSPESLKGRIIISTKPP 253 Sitka spruce
BAD02919     176 FEKCIKAIKANAFVSSKYPVVITLEDHLSspLQALAAETLTNILGEDLYYPPSSdgf---keLPSPESLKGKILISTKPP 252 Physcomitrella ...
XP_001766820 205 FKDCVIAIKENAFIASQYPVIITIENHMGaeMQKKAALVLREILGESLFYPSREqrp--plqFESPEVLKGFIIVSDQPP 282 Physcomitrella ...
BAD02928     218 FEDCVKAIKDNAFTTSAYPVVVTIESHLDleHQKEAARVLNKILGNIMFVPPPNelp--pqsFRSPEQLKHRIIISDKPP 295 Physcomitrella ...
EEH59920     181 FRNALKTIKQDAHTTSEYPVIITMENHCSklKRVELAKILLEELGDKLFIPLSLhl----nqWPSPSELKGRILIRDKIG 256 Micromonas pusi...
CAL54863     191 FEDAIKVIAERAHVASEYPVIVTLENHASkeTRAEMSRILRSTLGDKLWAPKSAvagnqlkrWPSPLELKGRVIVRDKIK 270 Ostreococcus tauri
Q9STZ3       174 LQECLDSIKEHAFTKCTYPLIITFKDGLKpeLQSKATQMIQQTFNHMVYHHDPHsl----evFPSPQQLRNKILISRRPP 249 thale cress
XP_001696502  98 FKECIEAIGEYAFKASPYPVIITMENHANteNQGLMAQILREVLGDKLFVPHPDdpm---eaWKSPEELKHKVVCRTSLK 174 Chlamydomonas r...
Feature 1                                                                                        
Q944C1       260 keyleandtkekdngekgkdsdedvwgkepedlistqsdldkvtssvnd------------------------------- 308 thale cress
ABR16641     254 keyletkttelqgdgdkeklktpdeepwgddipdygpdvpneresadpagp----------------------------- 304 Sitka spruce
BAD02919     253 keyleaavaqksalkdekilnelkkadklqeqstapvkspvekkiavppsektksiseekdlsekvgnlrvdsegesadp 332 Physcomitrella ...
XP_001766820 283 sdtiedqlavdpnaaqvlatdelddahastsdhtrhaqrlkkhikrahkkavlrv------------------------- 337 Physcomitrella ...
BAD02928     296 gdallsqaanepefaqqtllhevvrdpspdnrhehrhgrrgkkkklrrrqsqiae------------------------- 350 Physcomitrella ...
EEH59920     257 tkqvlreasgspylvrtqpipicrrfvdnaediarfeisddvtnreepceafsy-------------------------- 310 Micromonas pusi...
CAL54863     271 hkqdelqrrrdqrrglcglcgtkkqskqrkvlpkslnvrkndkvcamqsiie---------------------------- 322 Ostreococcus tauri
Q9STZ3       250 kellyandddgkvgvrngveir---------------------------------------------------------- 271 thale cress
XP_001696502 175 pnaheefkkliyiknskftglaemikkggvvvlrg--------------------------------------------- 209 Chlamydomonas r...
Feature 1                                                                                        
Q944C1       309 -------lnqddeergscesdtscqlqapeykrliaihagkpkgglrmalkvdpnkIRRLSLSEQLLEKava-----syG 376 thale cress
ABR16641     305 ------ieedsgddegisqvnpdkdvapeykrlitiragkpkgvslkdsirvdgkqVKRVSLSEPQLQKvar-----shP 373 Sitka spruce
BAD02919     333 apasspdgkkatltadsesddddnkknpeyarlitihqskpskgttvedrlkvegtVVRISLSETKLEKvte-----efP 407 Physcomitrella ...
XP_001766820 338 --antaakvlrksllvekievpetvefqeliylycakpsemkkakheegplvggdrAIMANLSEPQLQHfia-----rhP 410 Physcomitrella ...
BAD02928     351 --sriqklpsgklgdsgrpaiandpafdellyihcqkptemataqkkggplikgqhAIMANLSESQLDDlie-----dhT 423 Physcomitrella ...
EEH59920     311 ---fnfkfmrstnsyepptpssekvkqqvcnemfkslisienikikvikealeierVISCSWDELTLNNrkw----aldK 383 Micromonas pusi...
CAL54863     323 -----fprsstgvfdegavsssssdsegeqddedlkrivsvpnvkfrsfheardvpRFSCSWSERKLKLkie----kesS 393 Ostreococcus tauri
Q9STZ3       272 -----------------------------------qhpadpnyqslvsfhvveprgMLQNVLTGKANKIqrp----gwyE 312 thale cress
XP_001696502 210 ----------------------dvkelgaddadeeretqremeklqaqqakakaagHEGNSADETPEDAvvgggmvtgsI 267 Chlamydomonas r...
Feature 1                                                                    
Q944C1       377 ADVIRFTqKNFLRIYPKGTRFNSSNYKPQIGWMSGAQMIAFNMQGYGRALWLMEGMFRAN 436 thale cress
ABR16641     374 THVVRFThNNFLRIYPKGTRIDSSNYNPLLAWTHGAQMVAFNMQGYGRQLWLVHGFFRAN 433 Sitka spruce
BAD02919     408 ELVVKFTqRNILRVYPAGNRVNSSNYDPTAAWIHGAQMVAQNMQGYGKELWQAHGKFRGN 467 Physcomitrella patens
XP_001766820 411 GSLIEYSkMNLGRVYPFGLRFNSSNADPMLAWSHGFQIAALNLQGRDRPVWLAKGFFQVN 470 Physcomitrella patens subsp. patens
BAD02928     424 DSLIEFSkTNLTRVYPFGLRVTSSNADPMDAWEHGVQVAAINMQGRDRPVWISKAIFSRN 483 Physcomitrella patens
EEH59920     384 ATMLDFTgRHLLRCYPNRRRVTSQNFDPSLAWSMGAQMVALNFQTNDLAMWLNRGKFVAN 443 Micromonas pusilla CCMP1545
CAL54863     394 KDIIEFTnAHLLRTYPAGHRIFSNNYDPSEAWDVGASFVALNFQALDRYVWANRAKFRVN 453 Ostreococcus tauri
Q9STZ3       313 TDIISFTqKRFLRTRPQRKLLIYAPYKPQRAWMHGAQLIALSRKEEKEKLWLMQGMFRAN 372 thale cress
XP_001696502 268 QELYTYTgKHLMRVYPAGWRITSGNYNPMTAWIRGASFAALNWQVWDKPLWCNAGKFLDN 327 Chlamydomonas reinhardtii

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap