Conserved Protein Domain Family
PI-PLC1c_yeast

?
cd08598: PI-PLC1c_yeast 
Catalytic domain of putative yeast phosphatidylinositide-specific phospholipases C
This family corresponds to the catalytic domain present in a group of putative phosphoinositide-specific phospholipase C (PI-PLC, EC 3.1.4.11) encoded by PLC1 genes from yeasts, which are homologs of the delta isoforms of mammalian PI-PLC in terms of overall sequence similarity and domain organization. Mammalian PI-PLC is a signaling enzyme that hydrolyzes the membrane phospholipids phosphatidylinositol-4,5-bisphosphate (PIP2) to generate two important second messengers in eukaryotic signal transduction cascades, inositol 1,4,5-trisphosphate (InsP3) and diacylglycerol (DAG). InsP3 triggers inflow of calcium from intracellular stores, while DAG, together with calcium, activates protein kinase C, which then phosphorylates other molecules, leading to altered cellular activity. Calcium is required for the catalysis. The prototype of this CD is protein Plc1p encoded by PLC1 genes from Saccharomyces cerevisiae. Plc1p contains both highly conserved X- and Y- regions of PLC catalytic core domain, as well as a presumptive EF-hand like calcium binding motif. Experiments show that Plc1p displays calcium dependent catalytic properties with high similarity to those of the mammalian PLCs, and plays multiple roles in modulating the membrane/protein interactions in filamentation control. CaPlc1p encoded by CAPLC1 from the closely related yeast Candida albicans, an orthologue of S. cerevisiae Plc1p, is also included in this group. Like Plc1p, CaPlc1p has conserved presumptive catalytic domain, shows PLC activity when expressed in E. coli, and is involved in multiple cellular processes. There are two other gene copies of CAPLC1 in C. albicans, CAPLC2 (also named as PIPLC) and CAPLC3. Experiments show CaPlc1p is the only enzyme in C. albicans which functions as PLC. The biological functions of CAPLC2 and CAPLC3 gene products must be clearly different from CaPlc1p, but their exact roles remain unclear. Moreover, CAPLC2 and CAPLC3 gene products are more similar to extracellular bacterial PI-PLC than to the eukaryotic PI-PLC, and they are not included in this subfamily.
Statistics
?
PSSM-Id: 176540
View PSSM: cd08598
Aligned: 24 rows
Threshold Bit Score: 306.096
Threshold Setting Gi: 170104298
Created: 30-Sep-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:catalytic site [active site]
Evidence:
  • Comment:Both prokaryotic and eukaryotic PI-PLCs utilize a similar catalytic mechanism, a general base and acid catalysis involving two well conserved histidines. It consists of two steps, a phosphotransfer and a phosphodiesterase reaction.
  • Comment:Based on structure evidence of the catalytic site in Homo sapiens phospholipase C beta 2.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                         #                                                               
NP_983427     394 EEDYSRPLSEYFISSSHNTYLLGNQVGSMASVEGYIQALQQGCRSVEIDIWDSd-------------------------- 447  Ashbya gossyp...
AAZ23804      107 SQDLSYPLSSYFISSSHNTYLTGNQLSSESSVDAYRNVLLRGCRCIEVDVWDGsdsesedddgdaesvtsssssssdday 186  Neurospora cr...
EEY15550      178 DKDTSRPITNYFISSSHNTYLEGNQLASKSSPEAYREVLSRGCRCIEIDVWNGdtvaagsetnrsksprpdhsrnlsgas 257  Verticillium ...
XP_759129     721 QHDMTRPLSEYYISSSHNTYLVGGQWKGDSTVEGYIRALLQGARSVELDCWDGpn------------------------- 775  Ustilago mayd...
ABY68283      163 PQDMTHPLQHYFISSSHNTYLVGEQWKGESTVEGYIRVLLAGCRCVEMDVQSGd-------------------------- 216  Cryptococcus ...
CBI56765      127 ETDLTYPISNYFINSSHNTYLEGNQLSSKSSAEAYKAVLRNGCRCIEIDVWNGapsrtpsksphgehrrhisnvsamsrs 206  Sordaria macr...
XP_366606     147 QKDLSKPISHYFISSSHNTYLLGNQLTSVSSVEAYKTALEQDCRCIEIDVWNSpeyalglrtpsrsksprpghkrhlsas 226  Magnaporthe g...
XP_001730187  406 SGRLDEPLSSYYISSSHNTYLEGGQWKGDSTVEGYVRALHKGARCVELDCWDGpg------------------------- 460  Malassezia gl...
EDP52946       93 GEDLSAPITDYYISSSHNTYLTGNQLYSDAAAAAYTNVLLNGCRCVEIDVWDGdadddsvsgddtssssssssewssdee 172  Aspergillus f...
XP_758012     119 VRDRSRPLSEYFVSSSHNTYLLAHQLYGSSSAVAYEHVLIAGARCVEIDAWDNedd------------------------ 174  Ustilago mayd...
Feature 1                                                                                         
NP_983427         --------------------------------------------------------------------------------      Ashbya gossyp...
AAZ23804      187 gsgeegtasklkrkaksklpsflggrkks-------kdkkvpepttttppaaattteaapvglsaetnplercksggsas 259  Neurospora cr...
EEY15550      258 fanvaaslketvggvlggggagdras------------thsrslsaqsssglglrdsgflsdprvsgdkleggavvvppc 325  Verticillium ...
XP_759129         --------------------------------------------------------------------------------      Ustilago mayd...
ABY68283          --------------------------------------------------------------------------------      Cryptococcus ...
CBI56765      207 svrhgsslsvdh-----------------------------------------pglytmrtprdsgtsldpkelsdrldq 245  Sordaria macr...
XP_366606     227 sitsafeerldslkqvltgksysssqtttaktlkvppcdrrnsnnlevpstrnsdttfttgsntavddadekhvpethar 306  Magnaporthe g...
XP_001730187      --------------------------------------------------------------------------------      Malassezia gl...
EDP52946      173 npsrrkkqdvqktdgstqsaka---------------------psrrkglssklgsllgrkssppngatdkpastataaa 231  Aspergillus f...
XP_758012         --------------------------------------------------------------------------------      Ustilago mayd...
Feature 1                         #                                                               
NP_983427     448 ----------dGPVVCHGKLTS--------SLPLRNVVDVINKYAFITs----------PYPLILSLEIHCRseGQIIVK 499  Ashbya gossyp...
AAZ23804      260 lfqtlsrkstkEPRVLHGYTLTk-------DITFRDVCEAIKDYGFATt----------DLPLIVSLEVHCSaeQQERMV 322  Neurospora cr...
EEY15550      326 ppsprlpypknEPIVTHGWTLTt-------PCGFREVCVAIRESAFVTn----------DLPIIISLEVHADhqQQEVMV 388  Verticillium ...
XP_759129     776 ----------nVPQITHGRTLTs-------RVPFQDVISAIARYAFVTs----------PYPLILSLEVHADppQQEVMA 828  Ustilago mayd...
ABY68283      217 ----------vEPVVYHRKTLTs-------SVPVRDICRAIKQYGFVTs----------PYPIIISTEIHCTseQQNRLA 269  Cryptococcus ...
CBI56765      246 stsssgsikrvEPIVHHHGTMTt-------TVPFREVCKAVREEAFVTn----------HLPIIVSLEVGADreQQEMMV 308  Sordaria macr...
XP_366606     307 rrsrslanpsmEPVVMHAHTYAqrdwtlsnYVGFREVCRTIGKTAFVTn----------HLPIIISLEVHADaqQQDLMV 376  Magnaporthe g...
XP_001730187  461 ----------gQPQVTHGHTLTs-------RVPLDDVVAAVAQYAFVAs----------PYPLILSLEVHNDlaQQVVLA 513  Malassezia gl...
EDP52946      232 vgtaaqtlrrpEPRVLHGHTLTk-------GTKFRDVCYAIRDSAFVAs----------DLPVIVSLEVHTCieQQATMV 294  Aspergillus f...
XP_758012     175 ---------pqEPKVTHGYTLAs-------HVPFRAVCETMKQAIQKEqdeaqrdhsfkVAPILLSLENHCGhaGQKRLV 238  Ustilago mayd...
Feature 1                                                                                         
NP_983427     500 QLFDDILGPLIYVADHSv--------gWPSLRDLKHKIIIKSKKlrvnvdmaadiyhstsskgssydseydvqsqpsspm 571  Ashbya gossyp...
AAZ23804      323 DIMRQIWGDLLLPEPEEda------kyLPTPEELRGKILVKVKYappnneggstgsttpeeldntaaaasgglteeag-- 394  Neurospora cr...
EEY15550      389 AIMKEEWGDMLIDRAMDgldq---rfrVPSLEELRGKILIKCKKppkkievpfgsmrltksrtqeedtsasdednasqqq 465  Verticillium ...
XP_759129     829 RILIDTLGEMLLSQPIDsqtlpgstdeLPSPEKLKFKVLVKAKNvaaadghqalplpkaadglalsakqkdgtdviptmv 908  Ustilago mayd...
ABY68283      270 IILKEVFGHMLVSTPLVeef-----seLPSPEDLKGKILFKAKPpkpeanspkfetnffyqespsstdsdasfvrlarr- 343  Cryptococcus ...
CBI56765      309 EIMKEEWAGLLLEEPFEdcdh---lkqQPRLEQLLDKILIKVKRlddsngeiqeaqrgrsltvsslrsk----------- 374  Sordaria macr...
XP_366606     377 EIMQQEWGDLLLQEQIFgcdp---rlrLPTLEELQDKILIKVKKasvvansngtadslgipltalirgsvpgtssde--- 450  Magnaporthe g...
XP_001730187  514 NILQARLGDMLVTAPLDddvq---pgmLPSPEQLRFRILVKCKDhvwihsqvsqdaddqqplpqgrssssteqtewesds 590  Malassezia gl...
EDP52946      295 EIMEEAFKGMLIEVTPElea----sqaPPPLESLKRKILIKVKWvpatgdgqaeaqkddqtdtldtppsvnqdge----- 365  Aspergillus f...
XP_758012     239 EIMHEVWGDLLISGPVDknep---aseHTALDHLGAKIAVMVEFypseqppvaeeqdsddqeekknkakrneak------ 309  Ustilago mayd...
Feature 1                                                                                         
NP_983427     572 p-----------------------------------------------------------------rrgmrgihiskrkh 586  Ashbya gossyp...
AAZ23804      395 ---------------------------------------------------------------------qpkqrakkpsk 405  Neurospora cr...
EEY15550      466 qqqhhrhhp--------------------------------------------------sgtapkspppttgappkaakv 495  Verticillium ...
XP_759129     909 lepptsatdttsttdseiesrltsakqlvcrvtrrshrvqatsagqagyrsgdasddgtakasyetpgngsrsskatkkm 988  Ustilago mayd...
ABY68283      344 --------------------------------------------------------------------lsiqsknerpdt 355  Cryptococcus ...
CBI56765      375 ------------------------------------------------------------------------------pp 376  Sordaria macr...
XP_366606     451 ----------------------------------------------------------------------easgnpnrpk 460  Magnaporthe g...
XP_001730187  591 fldqar--------------------------------------------------------nlvrlarhrtergkiarp 614  Malassezia gl...
EDP52946      366 ------------------------------------------------------------------------papakpsk 373  Aspergillus f...
XP_758012     310 -------------------------------------------------------------------------kagiipe 316  Ustilago mayd...
Feature 1                                                                                         
NP_983427     587 rvieqllqisaihgitfrnfslpESKTPTHCFSLSERSFDNLANdd-lQRLAIDKHNrRHLMRVYPHAFRY----KSSNY 661  Ashbya gossyp...
AAZ23804      406 viwslskmgiytrgvsfkslmqpEANMPTHIFSLSESGVMDVHKe---SRSALFEHNkHYLMRAYPSGMRI----LSSNL 478  Neurospora cr...
EEY15550      496 pvcaalgdlaiythsehfkgfetVSKKPSHIYFIAESRILELYAt---MQSAVFTHNkNYFMRAFPNGARF----DSSNP 568  Verticillium ...
XP_759129     989 mstalaslliytigvkcrgfnkkESYATQHMVSLSEKTALKMIRdp-iSNEALIKHNrSHLTRIYPSMMSFarlhASRNF 1067 Ustilago mayd...
ABY68283      356 fspqlsellvythgvkyqgfsklNEYLPSHQFSVSERTAAKILKe---NKGDWIKHNfKHISRVYPRGTRL----GSTNF 428  Cryptococcus ...
CBI56765      377 icemlaalaiytrsehfsdlkslSSTTPSHIFSVNEDKFLDMISqdkaKLKKIMDHNkQYFMRIYPKGLRF----DSSNP 452  Sordaria macr...
XP_366606     461 isprlsklavythskhfggfstrVAKSPSHIFSLSEGSIQRWAKe---DPEGMKSHNkSFLMRAYPDPVSRv---DSGNM 534  Magnaporthe g...
XP_001730187  615 larelvrllvytvgvpfrglnkkEQYAAEHMFSLSERSAARLMRq---SHADLVKHNlTHLTRVYPSMTKLsrltSSANF 691  Malassezia gl...
EDP52946      374 ilhslsrlavftkgfsfrqftqpEAKVPGHVFSLSENAAREAYAk---DRDALLEHNrHFFMRVYPYGLRV----NSSNP 446  Aspergillus f...
XP_758012     317 lcslgvyaqsvkpvndswyaatlTNGPHDHLINISETGLLDLLPk---HSTAIKKHNaQHLMRVYPKGTRI----SSKNL 389  Ustilago mayd...
Feature 1                                           
NP_983427     662 DPIKCWRLGVQMVATNWQTYDLGQQLNQAMFRVT 695  Ashbya gossypii ATCC 10895
AAZ23804      479 DPAVFWRKGIQIVALNWQNWDEGMMLNEGMFAGT 512  Neurospora crassa
EEY15550      569 DSSLFWRKGVQMVALNWQYLDEGMMLNEGMFAGE 602  Verticillium albo-atrum VaMs.102
XP_759129    1068 VPLDMWAAGCQLVALNWQTTDLGFELNQAMFSRN 1101 Ustilago maydis 521
ABY68283      429 NPVDAWSAGCQIVALNWQTLDESILLNHAMFHGS 462  Cryptococcus neoformans var. grubii
CBI56765      453 DPTIPWRRGVQMVAMNWQKTDEGTMLNDAMFADT 486  Sordaria macrospora
XP_366606     535 DPAFCWRRGVQMVAMNWQTLDGEMMINHAMFADQ 568  Magnaporthe grisea 70-15
XP_001730187  692 LPMDMWASGCQLVALNWQTHDQGMSQNLALFARS 725  Malassezia globosa CBS 7966
EDP52946      447 DPTFFWRCGAQIVALNWQNLDKGMMLNRGMFTSE 480  Aspergillus fumigatus A1163
XP_758012     390 NPVPFWGVGAQVCALNWQTFDHSMQLNEALFSGS 423  Ustilago maydis 521

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap