Conserved Protein Domain Family
PI-PLCc_epsilon

?
cd08596: PI-PLCc_epsilon 
Catalytic domain of metazoan phosphoinositide-specific phospholipase C-epsilon
This family corresponds to the catalytic domain present in metazoan phosphoinositide-specific phospholipase C (PI-PLC, EC 3.1.4.11)-epsilon isozymes. PI-PLC is a signaling enzyme that hydrolyzes the membrane phospholipids phosphatidylinositol-4,5-bisphosphate (PIP2) to generate two important second messengers in eukaryotic signal transduction cascades, inositol 1,4,5-trisphosphate (InsP3) and diacylglycerol (DAG). InsP3 triggers inflow of calcium from intracellular stores, while DAG, together with calcium, activates protein kinase C, which then phosphorylates other molecules, leading to altered cellular activity. Calcium is required for the catalysis. PI-PLC-epsilon represents a class of mammalian PI-PLC that has an N-terminal CDC25 homology domain with a guanyl-nucleotide exchange factor (GFF) activity, a pleckstrin homology (PH) domain, an array of EF hands, a PLC catalytic core domain, a C2 domain, and two predicted RA (Ras association) domains that are implicated in the binding of small GTPases, such as Ras or Rap, from the Ras family. The PLC catalytic core domain is a TIM barrel with two highly conserved regions (X and Y) split by a highly degenerate linker sequence. There is one PI-PLC-epsilon isozyme (1). PI-PLC-epsilon is activated by G alpha(12/13), G beta gamma, and activated members of Ras and Rho small GTPases. Aside from PI-PLC-epsilon identified in mammals, its eukaryotic homologs have been classified with this family.
Statistics
?
PSSM-Id: 176538
View PSSM: cd08596
Aligned: 6 rows
Threshold Bit Score: 405.002
Threshold Setting Gi: 260817659
Created: 2-Oct-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:catalytic site [active site]
Evidence:
  • Comment:Both prokaryotic and eukaryotic PI-PLCs utilize a similar catalytic mechanism, a general base and acid catalysis involving two well conserved histidines. It consists of two steps, a phosphotransfer and a phosphodiesterase reaction.
  • Comment:Based on structure evidence of the catalytic site in Homo sapiens phospholipase C beta 2.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                         #                                            #                  
Q9P212       1391 IKELQLPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPIIYHGHTLTTKIPFKEVVEAID 1470 human
NP_001155125 1359 LDELQHPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPVIYHGHTLTTKIPFKDVVEAIN 1438 zebrafish
NP_001129927  927 EEDLRYPLSHYYINSSHNTYLTGHQLKGPSSSEMYRQVLLTGCRCVELDCWDGDDGLPLIYHGHTLVSKIGFRQVVEIIK 1006 nematode
XP_002603703  370 KEDMDQTLSHYYIASSHNSYLTGHQLRGESSVELYREVLLTGCRCVELDCWDGEDGNPIIYHGHTLTTKIPFRDVVEAIN 449  Florida lancelet
XP_002189419 1918 IEDLQFPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPIIYHGHTLTTKISFKEVVEAIE 1997 zebra finch
EEZ97838      416 ESDMGRPMSTYYVASSHNTYLTGHQLKGESSVELYSQVLLTGCRCVELDCWDGDDGFPMIYHGHTFTTKIPFNAVVETID 495  red flour beetle
Feature 1                                                                                         
Q9P212       1471 RSAFINSDLPIIISIENHCSLPQQRKMAEIFKTVFGEKLVTKFLFETDFsDDPMLPSPDQLRKKVLLKNKKlkahqtpvd 1550 human
NP_001155125 1439 RAAFVNSEMPVILSIENHCSLPQQRKMAEIFKMVFGEKLVTKFLFESDFaDEPLLPSPLQLRGKILLKNKKlkahqapvd 1518 zebrafish
NP_001129927 1007 KSAFITSDLPVILSIENHCSLQQQAKMAQMFKTVLGDLLVSNFLFEADFsDSPRLPCPLQMKNKILIKNKKmivdpptpl 1086 nematode
XP_002603703  450 DSAFLASDYPVILSIENHCCLQQQVKMAHCFTSILGEKLVTRFLFESDAvDDPSLPSPNQLKGRILLKNKTlhpyripvd 529  Florida lancelet
XP_002189419 1998 RNAFITSDMPVIISIENHCSLPQQRKMAEIFKNVFGDKLVTKFLFESDFsDDPMLPSPGQLRRKILLKNKKlkahqtpvd 2077 zebra finch
EEZ97838      496 KNAFVTSPYPVILSIENHCSLQQQTRMALVFQRVFGEKLVTNFLFEADYsDEPSLPSPEQLKNRILIKNKKlimevpapl 575  red flour beetle
Feature 1                                                                                         
Q9P212       1551 ilkqkahqlasmqvqaynggnanprpanneeeedeedeydydyeslsddni----------------------------- 1601 human
NP_001155125 1519 ilkqkahqlahmqaqanngtvsttplgnndeeeeeedeydydyeslsdd------------------------------- 1567 zebrafish
NP_001129927 1087 pmiergavqrgetqlnlhrkqsknsyesstvdevedddldeflddeeneeddqeevqvrsekeds--------------- 1151 nematode
XP_002603703  530 llrqkahllasqqqtinisteqvtmdtgslsedeldddyleeeedsdmpsspfnprdiptsptgvgnwtlhkgspsspsl 609  Florida lancelet
XP_002189419 2078 ilkqkahqlahlqaqasngasnptptneeeedeedeydydyeslsdadvlnaspapns---------------------- 2135 zebra finch
EEZ97838      576 sfsamstpgrpgsgirhsvpgrtssiisntssssfnddfsdddyd----------------------------------- 620  red flour beetle
Feature 1                                                                                         
Q9P212       1602 --------------------------------------------------ledrpenkscndklqfeyneeipkrikkad 1631 human
NP_001155125 1568 ----------------------------------------------------nilddkpegkssteklqyesndempkrf 1595 zebrafish
NP_001129927 1152 -------------------------------------pktskraeksarnikqqdslcsdhsveqakpstskttsktndr 1194 nematode
XP_002603703  610 vtewtfprgspssfslgsafppnkgssptstkgspsmtrkgssktlprgwgrplsfpesitsffshdaeevtqlrtksdp 689  Florida lancelet
XP_002189419 2136 --------------------------------------------qedniledrpenklssdklqfeyneenakrlkkadc 2171 zebra finch
EEZ97838      621 --------------------------------------------------------deddednidekaihgilsanespr 644  red flour beetle
Feature 1                                                                                         
Q9P212       1632 nsacnkgkvydmelgeefyldqnkkesrqiAPELSDLVIYCQAVKFPGLStlnasgssrgkerksrksifgnnpgrmspg 1711 human
NP_001155125 1596 kkagskgkmfdmelgeefylpqnekesrqiAQELSDLVIYCQAIKFPGLStlspsgsgrgkdrksrksifgsapargspg 1675 zebrafish
NP_001129927 1195 ktedevlyaqlaqnairnqqprknntgvqiAPELSDIVIYMQATKFKGFPpvdgiqsprimeegpasaslsfssrartps 1274 nematode
XP_002603703  690 ssrdsarrhtflvdnqpivvpkeeketsqvAPELSDLVPYLQAVKFRGFPseqsslkrerastrksslprd--------- 760  Florida lancelet
XP_002189419 2172 atynnkgkvydmelgeefylpqnkkesrqiAPELSDLVIYCQAVKFPGLStlnpsgssrgkerksrksifgnnpgrlspg 2251 zebra finch
EEZ97838      645 pygvphtvsktssqkraapddklkkrssqiSKELSDMVVYVQAIKFRGLNtispsssvkqrqrtvmsssgssivttgsss 724  red flour beetle
Feature 1                                                                                         
Q9P212       1712 etasfnktsgksscegirqtweesssplnpttslsaiirTPKCYHISSLNENAAKRLCRRYSQKLTQHTACQLLRTYPAA 1791 human
NP_001155125 1676 epvt-lvrapgkaslegirmnseeqmclspstslssiirTPKCYHISSVNENAAKRLCRRYSQKLIQHTSCQLLRTYPAA 1754 zebrafish
NP_001129927 1275 nl-----lntpapprrqrsstqlsqelaaeflgsvranaTATCYQVTSLNENAAKKLMKRHPAKCVSYTRDHLIRTYPSA 1349 nematode
XP_002603703  761 ------------------ldrrpsgdrdsaqlnissimrTPKCYHISSINENTGKAQVRKHPGKLLTYPLYGLVLSTSTW 822  Florida lancelet
XP_002189419 2252 esaalakasgkgpfdamrqtwedpcspynspaslsaiirTPKCYHISSLNENAAKRLCRRYSQKLIQHTTCQLLRTYPAA 2331 zebra finch
EEZ97838      725 a-------snissgggggvsnesdatifesemkqvrpnvHLPCYQCSSINENTAKRLCRKQPLGVVAHTQTQLMRTYPAG 797  red flour beetle
Feature 1                                                   
Q9P212       1792 TRIDSSNPNPLMFWLHGIQLVALNYQTDDLPLHLNAAMFEAN 1833 human
NP_001155125 1755 TRIDSANPNPLIFWLHGVQLVALNYQTDDLPMQLNAALFEAN 1796 zebrafish
NP_001129927 1350 KHYDSSNFNPINCWAHGMQMVALNFQTPDVIMAVNQAMFEQS 1391 nematode
XP_002603703  823 TRFDSSNPNPMPFWLHGLQLVALNYQTDDVPMHLNSAMFQQN 864  Florida lancelet
XP_002189419 2332 TRIDSSNPHPLIFWLHGVQLVALNYQTDDLPLQLNAAMFEAN 2373 zebra finch
EEZ97838      798 MRIDSSNFNPVIFWSFGLQMAALNYQTDDTSMHLNTTMFEIN 839  red flour beetle

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap