Conserved Protein Domain Family
PI-PLCc_eta

?
cd08594: PI-PLCc_eta 
Catalytic domain of metazoan phosphoinositide-specific phospholipase C-eta
This family corresponds to the catalytic domain present in metazoan phosphoinositide-specific phospholipase C (PI-PLC, EC 3.1.4.11)-eta isozymes. PI-PLC is a signaling enzyme that hydrolyzes the membrane phospholipids phosphatidylinositol-4,5-bisphosphate (PIP2) to generate two important second messengers in eukaryotic signal transduction cascades, Inositol 1,4,5-trisphosphate (InsP3) and diacylglycerol (DAG). InsP3 triggers inflow of calcium from intracellular stores, while DAG, together with calcium, activates protein kinase C, which then phosphorylates other molecules, leading to altered cellular activity. Calcium is required for the catalysis. PI-PLC-eta represents a class of neuron-speific PI-PLC that has an N-terminal pleckstrin homology (PH) domain, an array of EF hands, a PLC catalytic core domain, a C2 domain, and a unique C-terminal tail that terminates with a PDZ-binding motif, a potential interaction site for other signaling proteins. The PLC catalytic core domain is a TIM barrel with two highly conserved regions (X and Y) split by a highly degenerate linker sequence. There are two PI-PLC-eta isozymes (1-2), both neuron-specific enzymes. They function as calcium sensors that are activated by small increases in intracellular calcium concentrations. The PI-PLC-eta isozymes are also activated through GPCR stimulation. Aside from the PI-PLC-eta isozymes identified in mammals, their eukaryotic homologs are also present in this family.
Statistics
?
PSSM-Id: 176536
View PSSM: cd08594
Aligned: 8 rows
Threshold Bit Score: 390.702
Threshold Setting Gi: 115647130
Created: 2-Oct-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:catalytic site [active site]
Evidence:
  • Comment:Both prokaryotic and eukaryotic PI-PLCs utilize a similar catalytic mechanism, a general base and acid catalysis involving two well conserved histidines. It consists of two steps, a phosphotransfer and a phosphodiesterase reaction.
  • Comment:Based on structure evidence of the catalytic site in Homo sapiens phospholipase C beta 2.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                      #                                            #                  
O75038     325 HQDMTQPLSHYFITSSHNTYLVGDQLMSQSRVDMYAWVLQAGCRCVEVDCWDGPDGEPIVHHGYTLTSKILFKDVIETIN 404  human
XP_783611  398 NQDMTQPLSHYYIASSHNTYLLGDQLMSQSSVDVYGLVLQAGCRCVELDTWDGKDGEPVIYHGYTLTSKIKFRDVITVVN 477  purple urchin
EDO46562   297 YQDMTRPLSHYFIASSHNTYLTGDQLASASSMDMYVRVLQSGCRCLELDCWDGKDGEPVVYHGYTMTSKVKFRYVILNIN 376  Nematostella vec...
EAW78747    89 YQDMDQPLCNYYIASSHNTYLTGDQLLSQSKVDMYARVLQEGCRCVEVDCWDGPDGEPVVHHGYTLTSKILFRDVVETIN 168  human
CAP09295   150 NQDMDQPICNYFIASSHNTYLTGDQLLSHSKTDMYAWVLQAGCRCVEVDCWDGPDGEPMVQHGYTLTSKITFKSVIETIN 229  zebrafish
XP_422832  523 HQDMDQPLCNYFIASSHNTYLTGDQLLSQSRVEMYARVLQDGCRCIEVDCWDGPDGEPVVHHGYTLTSKIFFRDVAETIN 602  chicken
XP_425738  324 NQDMSYPLSHYFITSSHNTYLMGDQLMSQSRVDMYAWVLQSGCRCVEVDCWDGPDGEPIVHHGYTLTSKILFKDVIETIN 403  chicken
CAG07012   311 NQDMTQPLNHYFIATSHNTYLSGDQLLSQSRVEMYAYVLQAGCRCVEVDCWDGPDGEPIIHHGYTLTSKILFKDVIETIN 390  spotted green pu...
Feature 1                                                                                      
O75038     405 KYAFIKNEYPVILSIENHCSVIQQKKMAQYLTDILGDKLDLSSVSsedattLPSPQMLKGKILVKGKKlpanisedaeeg 484  human
XP_783611  478 KYAFMSSPYPVILSIENHCTLEQQKKMARYLLEILGDQLIISSPPegssggLPSPESLKYKILIKAKKlpldhdadleag 557  purple urchin
EDO46562   377 DFAFLNNRYPVILSLENHCSVEQQKFMANFMRDTFKDILCILFFMlfdgkdLPSPQELMGKILIKTKKlpvalsedleeg 456  Nematostella vec...
EAW78747   169 KHAFVKNEFPVILSIENHCSIQQQRKIAQYLKGIFGDKLDLSSVDtgeckqLPSPQSLKGKILVKGKKlpyhlgddaeeg 248  human
CAP09295   230 KYAFVNNEFPVILSIENHCSIQQQKKIAQHLKEIFGDKLDVGEALnkdpkqLPSPNLLKGKILLKGKRlpsylsadaeeg 309  zebrafish
XP_422832  603 KYAFIKNEFPVILSIENHCSIQQQKKIAQYLKEILGDKLDLSSVVtgdsrqLPSPQNLKGKILVKGKKlpyslgadaeeg 682  chicken
XP_425738  404 KYAFIKNEYPVILSIENHCSVVQQKKMAQYLTEILGDKLDLSSVHnddstrLPSPASLKGKILVKGKKlpanisddaeeg 483  chicken
CAG07012   391 KHAFTKSQYPVILSIENHCSVPQQKKMAEYLKEVLQDKLDLSVVIsndckrLPSPEILKGKVLIKVRPrkilvkvnaarv 470  spotted green pu...
Feature 1                                                                                      
O75038     485 evsdedsadeidddckllngdastnrkrventakrkldslikeskirdcedpnnfsvstlspsgklgrkskaeedv---- 560  human
XP_783611  558 evseedsadeldedfklektetrskfesiamaqlalmrkkpispsqqawqkiahklkekntenkaskngktgltgtf--- 634  purple urchin
EDO46562   457 evteedsademdecfkfrsdevnplkrntrkcilhpfvafvcetlwlltkattttrppnlvmtrtdnetydlsrnssils 536  Nematostella vec...
EAW78747   249 evsdedsadeiedeckfklhysngttehqvesfirkklesllkesqirdkedpdsftvrallkatheglnahlkqsp--- 325  human
CAP09295   310 evsdddsadeieddfklknstsngpsqhqveshirkkldslmkesqigdkedtdsfsirallratheglqrnlr------ 383  zebrafish
XP_422832  683 evsdedsadeieddcklkscysngatehqvesfirtklesllkesqirdkedpdsftvrallratheglsvnlkqnl--- 759  chicken
XP_425738  484 evsdedsadeidddckimngdastnrkrveniakkkldslikeskirdcedpnnftvttlpssgkagqksdskknkledd 563  chicken
CAG07012   471 tqhsatinpfsrgkncqrasilmqkkvmflmktlgmrkrkmmmtnrqfhprqtdrekentyvlfaclkggnsvssa---- 546  spotted green pu...
Feature 1                                                                                      
O75038     561 -------esgedagasrrngrlvvgsfsrrkkkgsklkkaasveegdegqdspggqsrgatrqkktmklsralsdlvkyt 633  human
XP_783611  635 ------rklkatrrraklqhssesdnnssmeydrsssrdddlegganenqqaeqakqrmssanrkrafvlsrqlsdlvky 708  purple urchin
EDO46562   537 spetrqrglrhtlkrsfstkenkekkrkevtksrsfstadedpkkvtkrkrsralsremgskrtirlsrhlsdlvaytqs 616  Nematostella vec...
EAW78747   326 -------dvkesgkkshgrslmtnfgkhkkttksrsksystddeedtqqstgkeggqlyrlgrrrktmklcrelsdlvvy 398  human
CAP09295   384 ---------knskdgmkksqsrsfisnlkhkrhsksrlkcqsveteddsqqepsggqfnrggrrrktiklsrdlsdlvvf 454  zebrafish
XP_422832  760 -------dtkeggkkshsrslmgnfgkhkktgkatskcstsdddenqqnssgkeagqlhrltrrrktvklcralsdlvvy 832  chicken
XP_425738  564 aesgedfstnkrhsrtlmgsfskrkkkgsklkkstsleegeddadsqgnvargsvhytrinrqkktmklsralsdlvkyt 643  chicken
CAG07012   547 --------sstkkkrrfgraimrsfkrkrkkwvqvknkamsdaesnysssrerteivyhpkkrktmrlsralsdlvkytk 618  spotted green pu...
Feature 1                                                                                      
O75038     634 ksvathdiemeaassWQVSSFSETKAHQILQQKPAQYLRFNQQQLSRIYPSSYRVDSSNYNPQPFWNAGCQMVALNYQSE 713  human
XP_783611  709 trsvafkgfpenmpcWELPSLGEMRANNLAMTRAADFATFSTHNMCRVYPSAYRIDSSNFNPQPLWNCGCQLVALNYQTE 788  purple urchin
EDO46562   617 rafkgleveedgenhWEVISIPEPRAYRFTDTKATQFTRYTRYKLCRIYPAGYRIDSSNPNPQTFWNCGCQLVALNYQTE 696  Nematostella vec...
EAW78747   399 tnsvaaqdivddgttGNVLSFSETRAHQVVQQKSEQFMIYNQKQLTRIYPSAYRIDSSNFNPLPYWNAGCQLVALNYQSE 478  human
CAP09295   455 tnsvasqecldegspCNVLSFSEARAQNLVHHRAERFLTFNQRQLSRIYPSAYRIDSSNFNPQTYWNVGCQLVALNYQTE 534  zebrafish
XP_422832  833 tnsvaaqdivddgstGNVLSFSETRAHQAVQQKAEQFMLYNQKQLTRVYPSAYRIDSSNFNPLPYWNVGCQLVALNYQSE 912  chicken
XP_425738  644 ksvgihdveteisssWQVSSFSETKAHQILQQKPAQYLRFNQHQLSRIYPSSYRVDSSNYNPQPFWNAGCQLVALNYQSE 723  chicken
CAG07012   619 svrvhdietqaftnsWQVSSLNETVMNQIIQLKPSELVRLNQRQLLRVYPSNYRVDSSNFNPQPYWNTGCHMVALNYQTE 698  spotted green pu...
Feature 1                    
O75038     714 GRMLQLNRAKFSAN 727  human
XP_783611  789 GRAMQLLRAKFRAN 802  purple urchin
EDO46562   697 GRMLQINRGKFRAN 710  Nematostella vectensis
EAW78747   479 GRMMQLNRAKFKAN 492  human
CAP09295   535 GRMMQLNRAKFMVN 548  zebrafish
XP_422832  913 GRMMQLNEAKFRVN 926  chicken
XP_425738  724 GRMLQLNRAKFSAN 737  chicken
CAG07012   699 GRMLELNRAKFSAN 712  spotted green pufferfish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap