1DJG,1QAS,1DJX


Conserved Protein Domain Family
PI-PLCc_delta

?
cd08593: PI-PLCc_delta 
Click on image for an interactive view with Cn3D
Catalytic domain of metazoan phosphoinositide-specific phospholipase C-delta
This subfamily corresponds to the catalytic domain present in metazoan phosphoinositide-specific phospholipase C (PI-PLC, EC 3.1.4.11)-delta isozymes. PI-PLC is a signaling enzyme that hydrolyzes the membrane phospholipids phosphatidylinositol-4,5-bisphosphate (PIP2) to generate two important second messengers in eukaryotic signal transduction cascades, Inositol 1,4,5-trisphosphate (InsP3) and diacylglycerol (DAG). InsP3 triggers inflow of calcium from intracellular stores, while DAG, together with calcium, activates protein kinase C, which then phosphorylates other molecules, leading to altered cellular activity. Calcium is required for the catalysis. PLC-delta represents a class of mammalian PI-PLC that has an N-terminal pleckstrin homology (PH) domain, an array of EF hands, a PLC catalytic core domain, and a C-terminal C2 domain. This CD corresponds to the catalytic domain which is a TIM barrel with two highly conserved regions (X and Y) split by a highly degenerate linker sequence. There are three PI-PLC-delta isozymes (1,3 and 4). PI-PLC-delta1 is relatively well characterized. It is activated by high calcium levels generated by other PI-PLC family members, and therefore functions as a calcium amplifier within the cell. Different PI-PLC-delta isozymes have different tissue distribution and different subcellular locations. PI-PLC-delta1 is mostly a cytoplasmic protein, PI-PLC-delta3 is located in the membrane, and PI-PLC-delta4 is predominantly detected in the cell nucleus. Aside from three PI-PLC-delta isozymes identified in mammals, some eukaryotic PI-PLC-delta homologs have been classified to this CD.
Statistics
?
PSSM-Id: 176535
View PSSM: cd08593
Aligned: 18 rows
Threshold Bit Score: 472.207
Threshold Setting Gi: 198415277
Created: 2-Oct-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 2 residues -Click on image for an interactive view with Cn3D
Feature 1:catalytic site [active site]
Evidence:
  • Comment:Both prokaryotic and eukaryotic PI-PLCs utilize a similar catalytic mechanism, a general base and acid catalysis involving two well conserved histidines. It consists of two steps, a phosphotransfer and a phosphodiesterase reaction.
  • Structure:1DJX; Rat Phosphoinositide-specific phospholipase C-Delta1 catalytic residues are well conserved in all eukaryotic PI-PLCs.
    View structure with Cn3D
  • Citation:PMID 9048554

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                        #                                            #                  
1DJG_A       163 YQDMDQPLSHYLVSSSHNTYLLEDQLTGPSStEAYIRALCKGCRCLELDCWDGPNqEPIIYHGYTFTSKILFCDVLRAIR 242 Norway rat
Q9BRC7       289 YQDMTQPLNHYFICSSHNTYLVGDQLCGQSSvEGYIRALKRGCRCVEVDVWDGPSgEPVVYHGHTLTSRILFKDVVATVA 368 human
AAS45642     298 YQDMKQPLAHYFINSSHNTYLLDDQLRGPSStEAYISALQRGCRCVELDCWDGPDnDPIVYHGHTLTSKIKFRDIIEVVD 377 Strongylocentro...
EEC13108     313 CQDMSQPLNHYYIASSHNTYLVQGQLMGSSSvEGYIRALKKGCRCLELDVWDGPNnEPVVYHGYTLTSKILFRDILDSVK 392 Ixodes scapularis
XP_001630292 206 YQDMRQPLSHYFIASSHNTYLMEDQLKGPSSvDAYINAFNKGCRCVELDCWDGDNgDPIVYHGHTLTSKIKFKDIIQAVA 285 starlet sea ane...
XP_002586902  31 YQDMTQPLSHYFIASSHNTYLLEDQIRGPSSkEGYVRVLLKGCRFLELDCWDGDDgEPVIYHGYTLTSKVLFRDVIEAIG 110 Florida lancelet
XP_001623656  91 YQDMNQPLSHYFIASSHNTYLLGHQLKGSSSvQAYRDVLERGCRCVELDCWDGDDeEPIVYHGHTLTSKVLFKDIVQAIK 170 starlet sea ane...
XP_002129990 312 HMDMTRPLSHYYIASSHNTYLADDQLIGKSSvECYIRALERGCRCVELDCWDGEDgQPIIYHGYTLTSKIAFADVVEAIR 391 Ciona intestinalis
1DJX_B       163 YQDMDQPLSHYLVSSSHNTYLLEDQLTGPSStEAYIRALCKGCRCLELDCWDGPNqEPIIYHGYTFTSKILFCDVLRAIR 242 Norway rat
A5D6R3       312 YQDMSKPLAHYYISSSHNTYLTKDQVTSASStEPYIRALNQGCRCVELDCWDGDKgEPIIYHGHTLTSKVLFKEVIETIA 391 zebrafish
Feature 1                                                                                        
1DJG_A       243 DYAFKASPYPVILSLENHCSLEQQRVMARHLRAILGPILLDQPLDgvt-tsLPSPEQLKGKILLKGKKLggllpaggeng 321 Norway rat
Q9BRC7       369 QYAFQTSDYPVILSLETHCSWEQQQTMARHLTEILGEQLLSTTLDgvlptqLPSPEELRRKILVKGKKLtleedleyeee 448 human
AAS45642     378 KYAFAASEYPLILSFENHCSVEQQKVMAQICVSILKDKLYTNNNLhne-aaFPSPEELKGKILIKGKSLppsaatteddg 456 Strongylocentro...
EEC13108     393 LYAFEDSQYPVILSLENHCSTEQQKVMAKHLVEILGDKLHNKPISdke-taMPPPSALLNKILIKGKKLnkdlsvdaddd 471 Ixodes scapularis
XP_001630292 286 EHAFKVSDYPVILSLENHCNIENQRKIAEHLENILGDKLFKDPVDtal-tsLPSPESLKGKVLIKGKKLkpeqemaavge 364 starlet sea ane...
XP_002586902 111 RYAFKASPYPVFLSLENHCSVVQQRLLATHMVNILGDSLCNIPSTpdm-qeLPSPQRLRGKIIVKNKKLkrnvveddvsd 189 Florida lancelet
XP_001623656 171 ESAFKVSPYPVIVSLENHCSVQFQIKMAEHLKGILGSLLYTTPVDftl-daLPSPKFFLNKILVRGKTGksivddkemdk 249 starlet sea ane...
XP_002129990 392 DYAFKTSDYPVILSIENHCSVPQQKKMALIMKETLGDMLLQNPVDpss-hmLPSPEALKGRILVKGKRLketnedeevsd 470 Ciona intestinalis
1DJX_B       243 DYAFKASPYPVILSLENHCSLEQQRVMARHLRAILGPILLDQPLDgvt-tsLPSPEQLKGKILLKGKKLggllpaggeng 321 Norway rat
A5D6R3       392 QYAFKASPYPLILSLENHCSVEQQAIMAQQLQSILGKKLLAKPLSdlplkqLPSPEELKGRILLKGKKLngllgkteswt 471 zebrafish
Feature 1                                                                                        
1DJG_A       322 seatdvsdeve------aaemedeavrsqvqhkpkedklKLVPELSDMIiYCKSVHFGGFSspgtsgqaFYEMASFSESR 395 Norway rat
Q9BRC7       449 eaepeleeselalesqfetepepqeqnlqnkdkkkkskpILCPALSSLViYLKSVSFRSFThske-hyhFYEISSFSETK 527 human
AAS45642     457 evsdedeaadi------dtedpqlkaeldkkkttskkklKLAKELSDLV-TLASVHYGSFPaske-kykCHQMSSFGEAK 528 Strongylocentro...
EEC13108     472 sedestskvngtp--lslvsecpnharfgrelsphptsgTLAEELSNIVnYCKASHFKSFEeae--kwhFYEMASFSEGK 547 Ixodes scapularis
XP_001630292 365 ddgtvsdedea------adieqedlaaaregeeskekkvKLAKELSRCVnYISSVGFKNFEhske-nakFYQMSSFVESK 437 starlet sea ane...
XP_002586902 190 edeaa------------------etedvevqervktskeKLAKELSDLVnICEAVHFHSFQhsre-ndmPYNMSSIKEGK 250 Florida lancelet
XP_001623656 250 eidsfdr--------------kvqiersvqetdfrgtkeHVADELSQLInYISNEKFKSFIesme-mghFSQTHSFVESE 314 starlet sea ane...
XP_002129990 471 edeaad----------------veengvkknpsktnkkiKLSKELSDLViYAQSRHFHNFPdakh-nsdFRHISSLNEDK 533 Ciona intestinalis
1DJX_B       322 seatdvsdeve------aaemedeavrsqvqhkpkedklKLVPELSDMIiYCKSVHFGGFSspgtsgqaFYEMASFSESR 395 Norway rat
A5D6R3       472 sftnssdee----------svaggnkkeskkdlarsastKLSPELSDLVvYCQSVPFSGFEtan--qrpPSVITSFSENE 539 zebrafish
Feature 1                                                                               
1DJG_A       396 ALRLLQ--ESGNGFVRHNVSCLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGPEMDVYLGCFQDN 464 Norway rat
Q9BRC7       528 AKRLIK--EAGNEFVQHNTWQLSRVYPSGLRTDSSNYNPQELWNAGCQMVAMNMQTAGLEMDICDGHFRQN 596 human
AAS45642     529 AFGLAE--DKPGDYVEHNKIFLSRIYPGGLRTNSSNYSPVPMWDVGAQIVALNFQTPCEEMDLNQGKFLQN 597 Strongylocentrotus purpu...
EEC13108     548 AAKLSStdQGARDFVRYNSKHLSRIYPKGTRTDSSNYDPVRYWNVGCQIVALNYQSWDQKMFMNEAKFSMN 618 Ixodes scapularis
XP_001630292 438 VATLAQ--NKAAGFVEYNTRQLSRTYPAGSRVDSSNYNPQVAWNVGCQIVALNYQTDGEYMHLNQGRFREN 506 starlet sea anemone
XP_002586902 251 ANHLVE--EQAADFIDHTKRQLVKIYPSGGRVDSSNIDPYLYWSVGCQIVALNYQTPCDQMDLNLGLFRQN 319 Florida lancelet
XP_001623656 315 MLYFLD--KSASEFVEFNKHQISRIYPGNLRVDSSNYDPIKPWTVGCQIVALNHQTNSEEMQLHYGKFRQN 383 starlet sea anemone
XP_002129990 534 AMNLYN--SQAEEFSEHNQWQLVRIYPKGTRTNSSNYDPLALWNVGCQIVALNYQTEDRETHINDALFRRN 602 Ciona intestinalis
1DJX_B       396 ALRLLQ--ESGNGFVRHNVSCLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGPEMDVYLGCFQDN 464 Norway rat
A5D6R3       540 ALKLIK--DSGKLFVRNNSRQLSRIYPSAQRLQSSNFDPQDMWNAGCQMVALNFQTPGEQMDLNQGRFLPN 608 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap