Conserved Protein Domain Family
PI-PLCc_gamma

?
cd08592: PI-PLCc_gamma 
Catalytic domain of metazoan phosphoinositide-specific phospholipase C-gamma
This family corresponds to the catalytic domain present in metazoan phosphoinositide-specific phospholipase C (PI-PLC, EC 3.1.4.11)-gamma isozymes. PI-PLC is a signaling enzyme that hydrolyzes the membrane phospholipids phosphatidylinositol-4,5-bisphosphate (PIP2) to generate two important second messengers in eukaryotic signal transduction cascades, inositol 1,4,5-trisphosphate (InsP3) and diacylglycerol (DAG). InsP3 triggers inflow of calcium from intracellular stores, while DAG, together with calcium, activates protein kinase C, which goes on to phosphorylate other molecules, leading to altered cellular activity. Calcium is required for the catalysis. PI-PLC-gamma represents a class of mammalian PI-PLC that has an N-terminal pleckstrin homology (PH) domain, an array of EF hands, a PLC catalytic core domain, and a C2 domain.The PLC catalytic core domain is a TIM barrel with two highly conserved regions (X and Y) split by a highly degenerate linker sequence. Unique to PI-PLC-gamma, a second PH domain, two SH2 (Src homology 2) regions, and one SH3 (Src homology 3) region is present within this linker region. There are two PI-PLC-gamma isozymes (1-2). They are activated by receptor and non-receptor tyrosine kinases due to the presence of two SH2 and a single SH3 domain within the linker region. Aside from the two PI-PLC-gamma isozymes identified in mammals, some eukaryotic PI-PLC-gamma homologs have been classified with this subfamily.
Statistics
?
PSSM-Id: 176534
View PSSM: cd08592
Aligned: 14 rows
Threshold Bit Score: 305.89
Threshold Setting Gi: 40365363
Created: 30-Sep-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:catalytic site [active site]
Evidence:
  • Comment:Both prokaryotic and eukaryotic PI-PLCs utilize a similar catalytic mechanism, a general base and acid catalysis involving two well conserved histidines. It consists of two steps, a phosphotransfer and a phosphodiesterase reaction.
  • Comment:Based on structure evidence of the catalytic site in Homo sapiens phospholipase C beta 2.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                         #                                            #                  
P19174        319 PDTMNNPLSHYWISSSHNTYLTGDQFSSESSlEAYARCLRMGCRCIELDCWDGPDgMPVIYHGHTLTTKIKFSDVLHTIK 398  human
CAA32194      311 MQDMNNPLSHYWISSSHNTYLTGDQLRSESSpEAYIRCLRMGCRCIELDCWDGPDgKPVIYHGWTRTTKIKFDDVVQAIK 390  human
XP_002168417   87 CQDMTKPLSCYWIASSHNTYLTGDQLQSESSfESYIRCLRMGCRCIELDCWDGPS-EPIIYHGLTLCTKINFVDVVKAIA 165  green hydra
BAA06189      317 FMDMNLPLSSYWIASSHNTYLTGDQFSSESScEAYARALRMGCRCIELDCWNGPDnLPYIFHGHTITSKIKFMDVIKTIK 396  fruit fly
ABM55782      318 TQDMDQPLSYYWIASSHNTYLTENQYSSESStEAYARVLQMGCRCIELDCWDGPDnLPHIYHGHTLTSKIRFMDVLYTIK 397  Chaetopterus ...
EEC01651      313 NQDMTQPLTHYWVASSHNTYLTGDQVKSESStEAYARCLSMSCRCIELDCWDGPDgMPYVYHGHTLTTKIRFIDVIKAIK 392  Ixodes scapul...
XP_002122548  323 DGMLDKPLSQYWISSSHNTYLTGDQFSSESScEAYARALRMGCRCIELDCWDGPDgMPHIYHGLTLTSKIKFHDVLKTIR 402  Ciona intesti...
AAR85355      302 VDDLDQPLCNYLIASSHNTYLTGDQIASESScEAYVRCLRMGCRCLELDCWDGPEgMPIIYHGLTLTSKIKFMDVLKTIK 381  Patiria miniata
XP_002187212  155 PEEMNHPLSQYWISSSHNTYLTGDQFSSESSlEAYARCLRMGCRCIELDCWDGPDdLPIIYHGHTLTSKIKFLDVLHTIK 234  zebra finch
XP_414166     511 VQDMNNPLSHYWISSSHNTYLTGDQLRSESStEAYIRCLRMGCRCIELDCWDGPDgKPIIYHGWTRTTKIKFDDVVQAIK 590  chicken
Feature 1                                                                                         
P19174        399 EHAFVASEYPVILSIEDHCSIAQQRNMAQYFKKVLGDTLLTKPVEiSADGLPSPNQLKRKILIKHKKLaegsayeevpts 478  human
CAA32194      391 DHAFVTSSFPVILSIEEHCSVEQQRHMAKAFKEVFGDLLLTKPTEaSADQLPSPSQLREKIIIKHKKLgprgdvdvnmed 470  human
XP_002168417  166 TYAFAESEYPLILSLENHCSIPQQIMMADIFKKYLGKYLVTQFLDpNETQLPSPESLKRKIILKNKRLidddlgssigsr 245  green hydra
BAA06189      397 DHAFTSSEYPVILSIEQNCSLEQQRNMAQALIEVFGDMLLTQPCDrNEQHLPSPYQLRRKIILKHKKLpqfddiangiss 476  fruit fly
ABM55782      398 ANAFLVSEYPIILSIENHCSLLQQRNMASAFREVFGDMLLIEPIDvNETVLPSPNQLKRRIILKHKKLpdgvdgtdwrma 477  Chaetopterus ...
EEC01651      393 EHAFVVSEYPVILSIENHCTLPQQRKMANLFQEVFGEMLLTQPIErDGTRMPSPEQLKRKIIIKHKKLpegtdekvivtr 472  Ixodes scapul...
XP_002122548  403 EHAFVVSDLPVILSIENHCKLPQQRHMATKFVDIFQDMLVRLSVSaNEQTLPSPNQLRGKIIIKHKKLsdanrstevfie 482  Ciona intesti...
AAR85355      382 EHAWVQSDLPIILSIENHCTLIQQRNMASSFQEVFGDSLLTQPVDrDATILPTVNQLRKKIILKHKKLmgtnetfsvpte 461  Patiria miniata
XP_002187212  235 EHAFVTSEFPIILSIEDHCSIVQQRNMACHFKKVFGDMLLTKPVDiNADELPSPTQLKKKILIKHKKLvegnlyeevsta 314  zebra finch
XP_414166     591 DHAFVTSEYPVILSIEEHCSVEQQRHMAKVFKEVFGDQLLMKPVEaSADQLPSPTQLKEKIIIKHKKLgpkgdidvnled 670  chicken
Feature 1                                                                                         
P19174        479 mmysendisnsikngilyledpvnhewyphyfvltsskiyyseetssdqgnedeeepkevssstelhsnekwfhgklgag 558  human
CAA32194      471 kkdehkqqgelymwdsidqkwtrhycaiadaklsfsddieqtmeeevpqdipptelhfgekwfhkkvekrtsaekllqey 550  human
XP_002168417  246 dslldedflasslktgliymededkkwnkhffvltsrvlyysdskeaaeddddnddensdadkkaggdedlhfsekwfhr 325  green hydra
BAA06189      477 tgslghrsslggagggahgendgenvrkvfkegllyfkdpvdkswnlyqfvlthqeliysseinesrngnsedddfglss 556  fruit fly
ABM55782      478 gladdmsvadgdlsnsikndilfledpidkewhphffvltqsklhytdetavtsqedeeeesndtslqleglgndemhfs 557  Chaetopterus ...
EEC01651      473 rgqetdvsnavkngilfledpvdkewrahffmltqnrmyyaeeqqaqdeedegegdgtglqqqrelhfgekwfhgklagg 552  Ixodes scapul...
XP_002122548  483 rstadltmdisnsvkngmmyfedptfkewnlhyfvltednklvyteerqtqphddttsedgsidesanndrrgssdttel 562  Ciona intesti...
AAR85355      462 emsgldlrnslkngilkiedpmdnewvphyfvltteklfyceqtqnlvnqdddddttsqldmqatpndelhfsepwfhgk 541  Patiria miniata
XP_002187212  315 sysendisnsikngilyledpidhtwsphyfvltsnkiyyseetsryqfnedeeeveqkeefnnnelhftekwfhgklgg 394  zebra finch
XP_414166     671 kkeekkqqgelymwdaieqqwtrhycaiadgklsfsdvieqnadedsskevkrtelhlkekwfhgkmkegrttaekllqe 750  chicken
Feature 1                                                                                         
P19174        559 rdgrhiaerllteycietgapdgsflvresetfvgdytlsfwrngkvqhcrihsrqdagtpkffltdnlvfdslydlith 638  human
CAA32194      551 cmetggkdgtflvresetfpndytlsfwrsgrvqhcrirstmeggtlkyyltdnlrfrrmyaliqhyrethlpcaefelr 630  human
XP_002168417  326 nisrqeaesllqeyqrgdgsflvrpsnmfvgdfslsfwrknrvqhchiksrptndgtakyflvgpkgfdnlyslinhyqt 405  green hydra
BAA06189      557 scslnsnmqqkqkdtsandelhfgenwfhgkleggrkeaddllkkykhfgdgtflvresatfvgdyslsfwrrnrpnhcr 636  fruit fly
ABM55782      558 ekwfhgkleggrrkaedllkeysylgdgtflvresdtfvgdfslsfwrkdsvnhcrirskqergqtkyylidnlafdsly 637  Chaetopterus ...
EEC01651      553 rlkaqellqqhshlgdgtflvresdtfvgdyslsfwrqgkvnhcrikskqergqtkyylidtvafdtlynlishyqthpl 632  Ixodes scapul...
XP_002122548  563 hyaekwyhgqmgrdeadqllrdyngkdgsfmvresatfignctlsfmyhgrvthcrihsqqnnghtyfylvhallfdsly 642  Ciona intesti...
AAR85355      542 lnsnsdvtprmlaeqllnqyqkgdgtflaresetfkgdyslsfwargkvnhcrirykldqsrpkyflvehtcfdslysli 621  Patiria miniata
XP_002187212  395 grdgrqiaekllheyctetggkdgtflvresetfvgdytlsfwrssrvqhcrihsrqeagatkfyltdnlvfdslyslic 474  zebra finch
XP_414166     751 ycaemggkdgtflvreseafpndctlsfwrsgrvqhcrirsssdgdtvkyyltdnvtfdsiydliqhykevhlrcaefdl 830  chicken
Feature 1                                                                                         
P19174        639 yqqvplrcnefemrlsepvpqtnaheskewyhasltraqaehmlmrvprdgaflvrkrnepnsyaisfraegkikhcrvq 718  human
CAA32194      631 ltdpvpnpnpheskpwyydslsrgeaedmlmriprdgaflirkregsdsyaitfrargkvkhcrinrdgrhfvlg----- 705  human
XP_002168417  406 nplksdkfelmltepvpqpnahlgkdwyhenltrlqaeemlr-------------------------------------- 447  green hydra
BAA06189      637 iklkhengsikyylvenfvfdslyslivyyrknmlrssefsiilkepvpqpkkhedqewfhpnttkeqaeqglyrleigs 716  fruit fly
ABM55782      638 slithyqkyplrsqdfqqilkepvpqpqshhgkpwyhekldrtraedmlkripsdgaflvrqngvdtnsyaisfraegk- 716  Chaetopterus ...
EEC01651      633 rsqefymylnepvpqpnkhegkewyhanmtrtqseellkrvkydgtflvrpsekedscfaisfraenkikhcrikqegr- 711  Ixodes scapul...
XP_002122548  643 slvwhyqryplrnakmnfellltepvpqpnahankewyhdsmtrtdaenvlmriprdgaflvrkcrsddpsvtsfaisfr 722  Ciona intesti...
AAR85355      622 shyrqcplrsrglellltepvpqplshegkdwfhkklsrpqaeemlkrvhqdgsflvrkreqgddsyaisfraegki--- 698  Patiria miniata
XP_002187212  475 hyrevplrcnefemrltdpvpqpnaheskewyhasltrlqaehmlmrvprdgaflvrkrsepnsyaisfrk--------- 545  zebra finch
XP_414166     831 rltdavpnpsphenkdwyysnlsrgeaedmlmriprdgaflirkrdepdsfamtfraegkvkhfriqqegrhfvl----- 905  chicken
Feature 1                                                                                         
P19174        719 qeg------------------qtvmlgnsefdslvdlisyyekhplyrkmklrypineealekigtaepdygalyegrnp 780  human
CAA32194      706 ------------------------------tsayfeslvelvsyyekhslyrkmrlrypvtpellerynterdinslydv 755  human
XP_002168417  448 ---------------------------------------------------------------rmrkdsyflvrkrndgd 464  green hydra
BAA06189      717 flvrpsvqsinafvisftinrkikhcrimqegclygidtmnfeslvslinyytrnplyrnvklshpvsqellrqalaeaa 796  fruit fly
ABM55782      717 --------------------------ikhciikqegrlftignaqfeslvelvnyyekkplyrkmklkhpvnekfvqsvg 770  Chaetopterus ...
EEC01651      712 -------------------------lfligtaqfeslvelvsyyekhplyrkvklkypvnedvirrigtepeespphagg 766  Ixodes scapul...
XP_002122548  723 adgkik------------hcrikqesrlfvignatfetlcdvisfyeknplyrkmklkhpatkeqvqcllqepnfysedh 790  Ciona intesti...
AAR85355      699 ---------------------------khcrinqegrlfaignahfesivelvsyyekfplyrkmklkypvnqeivdrlg 751  Patiria miniata
XP_002187212  546 ---------------------------------ctvkalydykaqredelsfckqaiihnvdkqdggwwrgdyggkkqlw 592  zebra finch
XP_414166     906 ------------------------------gtsayfeslvelvtyyekhplyrkmklrypvteellerystekdinslyd 955  chicken
Feature 1                                                                                         
P19174        781 gfyveanpmptfkcavkalfdykaqredeltfiksaiiqnvekqeggwwrgdyggkkqlwfpsnyveemvnpvalepere 860  human
CAA32194      756 srmyvdpseinpsmpqrtvkalydykakrsdelsfcrgalihnvskepggwwkgdygtriqqyfpsnyvedistadfeel 835  human
XP_002168417  465 qnesyaisfrtggtikhcvikkegrlfmigtapfeslteliahyeknplyrktklkypcnqdvvqefgmnpdgtfndpeq 544  green hydra
BAA06189      797 qgdhsgghddngasnymgsnleenvtckalysykankpdelsfpkhaiitnvqrdnsmwwigdyggmikkhlpanyvkvi 876  fruit fly
ABM55782      771 edpddtaiyggpgiymnpndftpkihvralydyraqmedelsfcknaiitnvikrdegwwlgdpgnqkrlyfpsnyveei 850  Chaetopterus ...
EEC01651      767 pagtymdpdsfsgasqmtvkalydyraqredelsfckhaiithvvrqdggwwrgnyggkrhhwfpanfvekpgcvefdat 846  Ixodes scapul...
XP_002122548  791 gavggsvayvppnfmsvtvkalydyraarddeltfckhaiisnvikqdggwwrgdyggkagmwfpsnyveemesaskepg 870  Ciona intesti...
AAR85355      752 gaadenslygnpelymdpnqfvpkvtvkalydykaqrddeltfckhaiitnvdkqdlgwwkgdyggkknmwfpsnyveet 831  Patiria miniata
XP_002187212  593 fpanyveeivgtqaqeqdeassensplgnflkgfidvpschvviskdgrsskpfvftihsqqmshaaqsldvaadtqeel 672  zebra finch
XP_414166     956 vkmyvepseitptvpqrtvkalydyrakrsdelsfsrgalihnvtketggwwkgdygekvqhyfpsnyvedlssdnsael 1035 chicken
Feature 1                                                                                         
P19174        861 hldensplgdllrgvldvpacqiairpegknnrlfvfsismasvahwsldvaadsqeelqdwvkkirevaqtadarlteg 940  human
CAA32194      836 ekqiiednplgslcrgildlntynvvkapqgknqksfvfilepkeqgdppvefatdrveelfewfqsireitwkidsken 915  human
XP_002168417  545 yvysqpnltmpkqackakydytaqkedelsftkgalivnimkydggwwrgdynghiqkwfpvnfteeitipskaeeeqak 624  green hydra
BAA06189      877 dsttedynslneegtdgrtdsieifgavaslfesndpgiifklqiqtptmqnpfvigfdnqetayewikaiqeaaliasq 956  fruit fly
ABM55782      851 rsqddvsdsmplgnmqkgtinvtgcavdrilngkgdkayvfriqhtanerpleiaaeteekmldwmkniracanlaeekv 930  Chaetopterus ...
EEC01651      847 yshavhlqsgeamplgtlqkgsidiagctvgnwpgrgrewvfrivsptqlvpieiaalsreemhdwvlkiretaqsandm 926  Ixodes scapul...
XP_002122548  871 stnlddaktgtnvlgdmqkgvidlansniellpsgrghqkhafricrsngdqlhlatetkddlvswlnnlkeaidkhdsq 950  Ciona intesti...
AAR85355      832 qpndnspestllgnlqkgaidirrcavetlpasrsthpnvfrisplnnrgaidlaasstedlsdwiqtiedaslkaearr 911  Patiria miniata
XP_002187212  673 sewvakireatqnadarmqegkimerrkkialelselvvyxyrdmssfpetkaekyanrskgkkflqynrrqlsriypkg 752  zebra finch
XP_414166    1036 esqiiednplgslchgilvlntynvvkmpqgkhkkpfvfilepknpedpcvefatdkveelfewyqsvreitwktaeeen 1115 chicken
Feature 1                                                                                         
P19174        941 kimerrkkialelselvvycrpvpfdeekigteracYRDMSSFPETKAEKYvnkaKGKKFLQYNr--LQLSRIYPKGQRL 1018 human
CAA32194      916 nmkyweknqsiaielsdlvvyckptsktkdnlenpdFREIRSFVETKADSIir-qKPVDLLKYNq--KGLTRVYPKGQRV 992  human
XP_002168417  625 pvdvllesqeigtinltgchlqiltsrpqrpyvfslKTSSGEFVCSVDTEQl--fYFLIFLTYHq--RQLSRVYPRGTRV 700  green hydra
BAA06189      957 laserrkkertarvakemsdliiyfrsvpfrehswiFQEMSSFPETKAEKQffqqNTQLFLSYHr--NQISRVYPKGQRL 1034 fruit fly
ABM55782      931 kkkhmieknkgiakefsdlivycrsvpfepekapgnYYDMSSFPETKGEKSlnrkDAAILMKYNk--YQLSRVYPKGSRI 1008 Chaetopterus ...
EEC01651      927 iqqrremerslrlakelsnliiycrsvqfcperignFTEMSSFPETKVEKWispqHCSFFLKYPfydCLFSRVYPKGSRI 1006 Ixodes scapul...
XP_002122548  951 akkwkdiekhtriavelsdlivycrpvqfnenakghCYEMSSFPESKAERYacrdKARIFINYNr--KQFSRIYPKGSRV 1028 Ciona intesti...
AAR85355      912 leetkherkmriakefsdlivycrsvpfrednipgkYYDMSSFPETKVERYltaiKSKLLLCYNq--HQVSRTYPKGQRF 989  Patiria miniata
XP_002187212  753 qrldssnydplpmwicgsqlvalnfqtpeigtdkacYRDMSSFPETKAEKYanrsKGKKFLQYNr--RQLSRIYPKGQRL 830  zebra finch
XP_414166    1116 rrkyweknqliaielsdlviyckptsktkdnlenpdFKEIRSFVETKAESIvk-qKPVELLKYNl--KGLTRVYPKGQRV 1192 chicken
Feature 1                                                
P19174       1019 DSSNYDPLPMWICGSQLVALNFQTpDKPMQMNQALFMTG 1057 human
CAA32194      993 DSSNYDPFRLWLCGSQMVALNFQTaDKYMQMNHALFSLN 1031 human
XP_002168417  701 DSSNYDPVPYWNIGSQMVALNYQTgDRPMQINNGLFMNN 739  green hydra
BAA06189     1035 DSSNFNPMPFWNVGSQMIALNYQTgDKAMQLNQAKFRNN 1073 fruit fly
ABM55782     1009 DSSNYDPQPFWNCGCHMLALNYQTpDRSMQLNEGKFKLN 1047 Chaetopterus variopedatus
EEC01651     1007 DSSNYDPVHLWNCGCQMVALNYQTpDRPMQLNQGRFLQN 1045 Ixodes scapularis
XP_002122548 1029 ESSNYNPMPFWNCGTQLAALNFQTgDRSMQLNEARFEMF 1067 Ciona intestinalis
AAR85355      990 DSSNYDPVPIWNIGTQMVSLNYQTpDRYMQINEGFFALN 1028 Patiria miniata
XP_002187212  831 DSSNYDPLPMWICGSQLVALNFQTpDKPMQLNQALFMLG 869  zebra finch
XP_414166    1193 DSSNYDPFRLWLCGSQMVALNFQTpDKYMQLNHALFSLN 1231 chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap