2O55


Conserved Protein Domain Family
GDPD_GsGDE_like

?
cd08564: GDPD_GsGDE_like 
Click on image for an interactive view with Cn3D
Glycerophosphodiester phosphodiesterase domain of putative Galdieria sulphuraria glycerophosphodiester phosphodiesterase and similar proteins
This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in putative Galdieria sulphuraria glycerophosphodiester phosphodiesterase (GsGDE, EC 3.1.4.46) and its uncharacterized eukaryotic homologs. Members in this family show high sequence similarity to Escherichia coli GP-GDE, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.
Statistics
?
PSSM-Id: 176507
View PSSM: cd08564
Aligned: 6 rows
Threshold Bit Score: 294.38
Threshold Setting Gi: 23497123
Created: 4-Dec-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 2 residues -Click on image for an interactive view with Cn3D
Feature 1:catalytic site [active site]
Evidence:
  • Comment:The catalytic mechanism of glycerophosphodiester phosphodiesterases is based on the metal ion-dependent general acid-base reaction.
  • Comment:Based on structure evidence and site-directed mutagenesis of Thermoanaerobacter tengcongensis glycerophosphodiester phosphodiesterase, the catalytic site consists of two conserved histidine residues which serve as general acid and general base in catalyzing the hydrolysis of the 3'-5' phosphodiester bond.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                 #                                                #                      
2O55_A                          4 VIIPKIVGHRGVGKeg-----laPENTLRSFVLCXERNiPYIETDLRVCKTGEIVLFHGtpegt---------------- 62  Galdieria sulphuraria...
XP_001610934                   13 MVRPLIYGHRGMGCslpgalsffPENSMTSFREAQRIGaDGIELDVFLSKNNELLVMHGylqkhslc------------- 79  Babesia bovis T2Bo...
TIGR:PF14_0060                 21 SPSASIVGHRGCGSstaggisryPENSLFSFKKALDENvDGVELDVWLTKDNQVIVLHGtedgllg-------------- 86  Plasmodium falciparum 3D7...
XP_002179026                  121 TSPPTIVGHRGALYd-------cLENTRQGFLRCAQIGvDAVELDVFLLRDNTLAVFHGggtdenpg------------- 180 Phaeodactylum tricornutum CCAP 1055/1...
WGS:AAGF:cds.TTHERM_00430070A  74 KNKIIAEGHRGAGIh-------mVENTLPCFRRGIEIGlNSVELDVWLTSDKQIVVVHGkdddt---------------- 130 Tetrahymena thermophila SB210...
XP_766180                       1 MVRTEVYGHRGMGCstvltfasyPENSLSAFEKALEAGaDGFEFDLFLTDYGEVVVCHGmepygaaclnlllyengklst 80  Theileria parva strain Muguga...
Feature 1                                                                                                         
2O55_A                         63 ---------------------------ipfyKDGTSRIGDLSLEELKRLdv----------------------------- 86  Galdieria sulphuraria...
XP_001610934                   80 -----------------------lttmkrkaDSGIQRFNTDNYVESEDVhatdlvlkkpwrltqksielqei-------- 128 Babesia bovis T2Bo...
TIGR:PF14_0060                 87 ------------------------htllcnkDCENKNIEELNLDEIQKYhfkepwilnhgktfnennyelnnnqkkyssl 142 Plasmodium falciparum 3D7...
XP_002179026                  181 ------------------------dlseycvGQDGRNILDLTYDECLRLqfnqhfdef---------------------- 214 Phaeodactylum tricornutum CCAP 1055/1...
WGS:AAGF:cds.TTHERM_00430070A 131 ---------------------------iqldDGSFKKINEMSFQEITEKyt----------------------------- 154 Tetrahymena thermophila SB210...
XP_766180                      81 fppdlsvqnltvshlnvvlkapwtlpglnsrDSVSEYSKKLSESEKRDLlqkylqeak---------------------- 138 Theileria parva strain Muguga...
Feature 1                                                                                                         
2O55_A                            --------------------------------------------------------------------------------     Galdieria sulphuraria...
XP_001610934                      --------------------------------------------------------------------------------     Babesia bovis T2Bo...
TIGR:PF14_0060                143 teqeklekeneyenfdkayinleehedieklinekflnnfynlnnknnyeepindteyiekekklfeeynldtninteed 222 Plasmodium falciparum 3D7...
XP_002179026                      --------------------------------------------------------------------------------     Phaeodactylum tricornutum CCAP 1055/1...
WGS:AAGF:cds.TTHERM_00430070A     --------------------------------------------------------------------------------     Tetrahymena thermophila SB210...
XP_766180                         --------------------------------------------------------------------------------     Theileria parva strain Muguga...
Feature 1                                                                                                         
2O55_A                         87 ------------------------------------ggGHTIPSLEELFVAIEeqkfnLKLNLELKGeewkrkesgDHQR 130 Galdieria sulphuraria...
XP_001610934                  129 ---------------pqhngsntdifeeyisnmeqsdsGECVPTLDQVLVEFGd---sLKYDIELKGsn-----vdLGLR 185 Babesia bovis T2Bo...
TIGR:PF14_0060                223 yinsikcshckdiykkymmpkthyhlkkkqllfkfismFYHVPLLENLLNLYKn---kLTYDIELKGnk-----edLGLY 294 Plasmodium falciparum 3D7...
XP_002179026                  215 ------------------------------pcgadeiaRGVIPTLEQVLRDLKpt--gCNVKVELKGp-------gTVEP 255 Phaeodactylum tricornutum CCAP 1055/1...
WGS:AAGF:cds.TTHERM_00430070A 155 ------------------------------------ikGEKCPLLRDVLFTCKd---kVHVNIEIKGre-----neMCEN 190 Tetrahymena thermophila SB210...
XP_766180                     139 -----------------------------gykpvngtdYERLPTLEDVFNKFGs---kVKYNLELKGtk-----vqLSEE 181 Theileria parva strain Muguga...
Feature 1                                                                                                         
2O55_A                        131 LLLLVEKYhxqeRVDYCSFHh------------------------------EALAHLKALCPD--------VKITYLFNY 172 Galdieria sulphuraria...
XP_001610934                  186 VLDVLSKHpg-lDVVISSFQwvapnlnlsssr-------annpleqypngtDVVDLLGPLINNkl-----nIPIALLFNN 252 Babesia bovis T2Bo...
TIGR:PF14_0060                295 ILNILQNYkd-yKFKFSSFNwllqyndiqekihkqennnsfnyeaypfynvDRIDLLKVLRNNkl-----nIPVALLFSD 368 Plasmodium falciparum 3D7...
XP_002179026                  256 SLKLVEELgmmnQVQFSSFYh------------------------------DRLKLLRELRPDkngngqyaVRTGALFDE 305 Phaeodactylum tricornutum CCAP 1055/1...
WGS:AAGF:cds.TTHERM_00430070A 191 VLNLVIECgmigQVHFSSFLh-----------------------------yHQPLLIQALESHnlp--tnsIQFGYLIWE 239 Tetrahymena thermophila SB210...
XP_766180                     182 VLKLLEKYrh-lDVFISSFMwippplnpsskf--------yhnenennpnkSPADLLLPLVGNhl-----nVPLALLFDT 247 Theileria parva strain Muguga...
Feature 1                                                                                                         
2O55_A                        173 xgqp--tpldFVEQACYGDA-----NGVSXLFHYl----------------tKEQVCTAHEKGLSVTVWXPWif------ 223 Galdieria sulphuraria...
XP_001610934                  253 etselpslerIVECCRHYNA-----TWAVVSHEFwkmgtpilgsdvkgkeavPYLVNYMHDHGLKVMSYFLEsr------ 321 Babesia bovis T2Bo...
TIGR:PF14_0060                369 deimp-dintILYTMKYYNA-----QWAHFSFRLkknsivvhsnpsnitipiEDFIKIFHNNNKKIMIYWGTed------ 436 Plasmodium falciparum 3D7...
XP_002179026                  306 vp------vdYLTQALDCGA-----TEVHLRYDTc----------------tVERVQAIHNAGLGTMAWFRGpvgmktdt 358 Phaeodactylum tricornutum CCAP 1055/1...
WGS:AAGF:cds.TTHERM_00430070A 240 hk-------dFQTFDQINFKgnilaFPCNFVYDEf----------------aLPYIFKAQERGMRLSTYFDFdv------ 290 Tetrahymena thermophila SB210...
XP_766180                     248 vsslp-svprVLEFVKKYKA-----SSVNVADSFwlnelpvlgleekremalERFVKEMHANGVKVLTYSTEp------- 314 Theileria parva strain Muguga...
Feature 1                                                                
2O55_A                        224 --------dDSEEDWKKCLELQVDLICSNYPFGLXNFLS 254 Galdieria sulphuraria
XP_001610934                  322 --------pDSDEELQVQIESGMDAVCPNDVVKCLGFVN 352 Babesia bovis T2Bo
TIGR:PF14_0060                437 --------nDKADDIFSYLKLDADSLCPNDIVLAKYVLQ 467 Plasmodium falciparum 3D7
XP_002179026                  359 knkfwdvgnEDEECYRVVMASGVQQLCCNRPVEALAFCN 397 Phaeodactylum tricornutum CCAP 1055/1
WGS:AAGF:cds.TTHERM_00430070A 291 --------iENFNIYKRLYDIGVDCIITNQPQLLVNFLK 321 Tetrahymena thermophila SB210
XP_766180                     315 --------fDNKDNVKLYFEYKVDRVCPNDVHTFVTFSK 345 Theileria parva strain Muguga

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap