2JV3


Conserved Protein Domain Family
SAM_PNT-ETS-1

?
cd08542: SAM_PNT-ETS-1 
Click on image for an interactive view with Cn3D
Sterile alpha motif (SAM)/Pointed domain of ETS-1
SAM Pointed domain of ETS-1 subfamily of ETS transcriptional activators is a protein-protein interaction domain. The ETS-1 activator is regulated by phosphorylation. It contains a docking site for the ERK2 MAP (Mitogen Activated Protein) kinase, while the ERK2 phosphorylation site is located in the N-terminal disordered region upstream of the SAM Pointed domain. Mutations of the kinase docking site residues inhibit phosphorylation. ETS-1 activators play a role in a number of different physiological processes, and they are expressed during embryonic development, including blood vessel formation, hematopoietic, lymphoid, neuronal and osteogenic differentiation. The Ets-1 gene is a proto-oncogene involved in progression of different tumors (including breast cancer, meningioma, and prostate cancer). Members of this subfamily are potential molecular targets for selective cancer therapy.
Statistics
?
PSSM-Id: 176092
View PSSM: cd08542
Aligned: 4 rows
Threshold Bit Score: 192.503
Threshold Setting Gi: 158429094
Created: 28-Jan-2010
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
ERK2 MAP kinase
Conserved site includes 3 residues -Click on image for an interactive view with Cn3D
Feature 1:ERK2 MAP kinase docking site [polypeptide binding site]
Evidence:
  • Comment:Kinase docking site is composed of a three hydrophobic residues. Mutations of these residues inhibit phosphorylation in vitro and impair Ras-MARK pathway-mediated enhancement of transactivation by ETS-1 in cell culture assays.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                       # #   #          
2JV3_A        23 ATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMSGAALCALGKECFLELAPDFVGDILWEHLE 102 house mouse
P13474        51 ATFSGFAKEQQRLGIPKDPQQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKECFLELRPDFVGDILWEHLE 130 chicken
P18755        49 ATFSRFTKEQQRLGIPIDPREWTDMHVREWVSWAVNEFTLKGVDFQKFCMSGAALCALGKECFLELAPDFVGDILWEHLE 128 African clawed ...
NP_001017558  43 ATFSGFTREQQRLSIPKDPREWTEGHVREWLTWTVNEFSLKNVDFHKFSMDGASLCALGKERFLDLAPDFVGDILWGHLE 122 zebrafish
Feature 1                
2JV3_A       103 ILQKEDVK 110 house mouse
P13474       131 ILQKEEAK 138 chicken
P18755       129 ILQKDSKQ 136 African clawed frog
NP_001017558 123 MLQKEDPK 130 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap