1SXE


Conserved Protein Domain Family
SAM_PNT-ERG

?
cd08540: SAM_PNT-ERG 
Click on image for an interactive view with Cn3D
Sterile alpha motif (SAM)/Pointed domain of ERG transcription factor
SAM Pointed domain of ERG subfamily of ETS transcriptional regulators is a putative protein-protein interaction domain. It may participate in formation of homodimers or heterodimers with ETS-2, Fli-1, ER81, and Pu-1. However, dimeric forms are inactive and SAM Pointed domain is not essential for dimerization, since ER81 and Pu-1 do not have it. In mouse, a regulator of this type binds the ESET histone H3-specific methyltransferase (human homolog is SETDB1), which leads to modification of the local chromatin structure through histone methylation. ERG regulators are involved in endothelial cell differentiation, bone morphogenesis and neural crest development. The Erg gene is a proto-oncogene. It is a target of chromosomal translocations resulting in fusions with other neighboring genes. Chimeric proteins were found in solid tumors such as myeloid leukemia or Ewing's sarcoma. Members of this subfamily are potential targets for cancer therapy.
Statistics
?
PSSM-Id: 176090
View PSSM: cd08540
Aligned: 4 rows
Threshold Bit Score: 165.136
Threshold Setting Gi: 182889944
Created: 4-Feb-2010
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1SXE_A    23 VPADPTLWSTDHVRQWLEWAVKEYGLPDVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLP 97  human
Q90837   127 VPADPTLWSTDHVRQWLEWAVKEYGLPDVDILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLP 201 chicken
AAI70483 134 VPADPTLWSTDHVRQWLEWAIKEYGLPDVDVLLFQNIDGKELCKMTKEDFHRLTPSYNADILLSHLHYLRERGAS 208 African clawed frog
AAI65846  77 VPADPGQWSAGHVRQWLDWAVQEYGLPPLDVSLFQGVDGKQLCRMSREELQRLTSSYSADVLLSHLHYLRETPLP 151 zebrafish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap