1LKY,1LKY,1SV0


Conserved Protein Domain Family
SAM_PNT-Tel_Yan

?
cd08535: SAM_PNT-Tel_Yan 
Click on image for an interactive view with Cn3D
Sterile alpha motif (SAM)/Pointed domain of Tel/Yan protein
SAM Pointed domain of Tel (Translocation, Ets, Leukemia)/Yan subfamily of ETS transcriptional repressors is a protein-protein interaction domain. SAM Pointed domains of this type of regulators can interact with each other, forming head-to-tail homodimers or homooligomers, and/or interact with SAM Pointed domains of another subfamily of ETS factors forming heterodimers. The oligomeric form is able to block transcription of target genes and is involved in MAPK signaling. They participate in regulation of different processes during embryoniv development including hematopoietic differentiation and eye development. Tel/Yan transcriptional factors are frequent targets of chromosomal translocations resulting in fusions of SAM domain with new neighboring genes. Such chimeric proteins were found in different tumors. Members of this subfamily are potential targets for cancer therapy.
Statistics
?
PSSM-Id: 176085
View PSSM: cd08535
Aligned: 10 rows
Threshold Bit Score: 123.652
Threshold Setting Gi: 260827260
Created: 29-Jan-2010
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
oligomeroligomer
Conserved site includes 13 residues -Click on image for an interactive view with Cn3D
Feature 1:oligomer interface EH [polypeptide binding site]
Evidence:
  • Structure:1LKY_B; human Tel-SAM_PNT domain complex, contacts at 4A
    View structure with Cn3D
  • Comment:SAM_PNT domains of Tel and Yan can form homodimers via interactions between the end-helix (EH) surface and the mid-loop (ML) surface.
  • Structure:1SV0; Drosophila melanogaster Yan (SAM_PNT domain)/Mae (SAM_PNT domain) dimer, contacts at 4A
    View structure with Cn3D
  • Comment:The EH surface of Yan SAM_PNT domain can interact with the ML surface of Mae SAM_PNT to form a heterodimer.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                           ######                          ### ##  ##       
1LKY_A        10 LQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDRLYELLQHILKQ 77   human
1LKY_B        10 LQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKDLLLLTKEDFRYRSPHSGDVLYELLQHILKQ 77   human
1SV0_A         8 SDPRLWSREDVLVFLRFCVREFDLPKLDFDLFQMNGKRLCLLTRADFGHRCPGAGDVLHNVLQMLIIE 75   fruit fly
Q9Y603        49 IQPALWSREDVLHWLRWAEQEYSLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQ 116  human
AAQ82054      56 MQPVFWSREDVCVWLRWAEREFALRPISSGSFQMNGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQ 123  zebrafish
XP_423579     56 LQPVYWSRDDVAQWLRWAEKEFSLRPIESNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQ 123  chicken
XP_002402447   1 NDPRQWSKHNVSMWLEWCTEQFSLVPTDADNFHMNGKALCLLSKADFLERAPKAGDVLFNALQLLLHR 68   black-legged tick
XP_002608583  11 IHPYQWTKADVLTWVRWAVDEFSLTGVDEQRFGMNGKALSLLGKEGFTDRVPFAGDVLYNLLHNLLQG 78   Florida lancelet
NP_001124423  56 LPPAHWSREDVSQWLRLAENEYSLHPIDANTFEMNGKALLLLTKEDFRYRCPHSGDVLYEVLQHTLKE 123  African clawed frog
XP_001947336 124 TDPRIWTKEDVTAFIQWAEVEFDLPRFETELFQMNGKALCLLTKQDLGERCPGAGDLLYNVLQLLRRG 191  pea aphid

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap