1SXD


Conserved Protein Domain Family
SAM_PNT-GABP-alpha

?
cd08534: SAM_PNT-GABP-alpha 
Click on image for an interactive view with Cn3D
Sterile alpha motif (SAM)/Pointed domain of GA-binding protein (GABP) alpha chain
SAM Pointed domain of GA-binding protein (GABP) alpha subfamily of ETS transcriptional regulators is a putative protein-protein interaction domain. This type of transcriptional regulators forms heterotetramers containing two alpha and two beta subunits. It interacts with GA repeats (purine rich repeats). GABP transcriptional factors control gene expression in cell cycle control, apoptosis, and cellular respiration. GABP participates in regulation of transmembrane receptors and key hormones especially in myeloid cells and at the neuromuscular junction.
Statistics
?
PSSM-Id: 176084
View PSSM: cd08534
Aligned: 12 rows
Threshold Bit Score: 149.81
Threshold Setting Gi: 115638770
Created: 29-Jan-2010
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1SXD_A         5 AALEGYRKEQERLGIPYDPIHWSTDQVLHWVVWVMKEFSMTDI-DLTTLNISGRELCSLNQEDFFQRVP--RGEILWSHL 81  house mouse
AAH44341     185 AALEGYRKEQVRLNIPYDPVQWTADQVIHWAVWVMKEFGIDEM-EVGGIHIPGRQLCGFSQEEFLQRVP--SGEILWSHL 261 zebrafish
BAD89997     168 AALEDYRKEQERLGIPYDPVQWSTDQVLHWVVWVMKEFSMSDI-DLNALSIPGRELCSLSQEDFFQRVP--RGEILWSHL 244 chicken
AAI00223     168 AALEGYRKEQERLGIPYDPLQWSVDQVLHWVLWVMKEFGLTDI-NVNSLGITGRELCNLNQEDFFQRVP--RGEILWSHL 244 African clawed ...
XP_002592064 146 AVCQNFRKEQEIKGIPLDPMEWTEENVAQWVEWVIQEFSLDGM-DPHHFQATGKDLCSLQQKDFLARSPagKGEILWTHL 224 Florida lancelet
XP_394741    624 LVDPQYKKEQERLKIPADPKEWTQTHVKHWLQWAVRQFNLASV-RLADWNITGQQLCNLTMEEFQAKVPldPGEVFWTHL 702 honey bee
XP_795790    254 IVCSNYRDEQDRLNIPYDPELWTEDHTLHWLIWASGEFANEALdHVKDIVMTGSEMCALTKEEFCERFQkeSEDLFWTHL 333 purple urchin
XP_001660245 147 VCDTNFKRDQQRLNIPDDPLEWTVAQVKHWIQWAVKIFQLTSI-KLQDWSISGKELCDMDHAEFKQKVPsdPGDLFWTHL 225 yellow fever mo...
Q04688       184 VLDSKFKREQIRLKIPEAANEWTHAHVTYWLEWAVKQFELVGI-NMSDWQMNGQELCAMTHEEFNQKLPrdPGNIFWTHL 262 fruit fly
XP_002428175 176 VIDSNFSKELERLKVPKDPKLWNKQHVKLWLVWAVRQFNLSGL-KLSDWMINGSDLCKMSLDSFKKKVPkdPDDLFWTHL 254 human body louse
XP_002399675 141 RFVFVLRKLQGGLVPRPDPTLWKPDQVLRWFQWACRHFGLQDA-NASDWNLTGKQLCELSHAEFVRRIAfdPGDLFWTHL 219 black-legged tick
XP_970323    212 QVDLAYKREQDRLKIPHDPMEWSQVHVRHWVQWAVRQFNLPSI-KLSDWSMTGRELYNLTVSDFQKIVPydPGDIFWTHL 290 red flour beetle
1SXD_A        82 ELLRKYVLAS 91  house mouse
AAH44341     262 ELLRKYVLAS 271 zebrafish
BAD89997     245 ELLRKYVLAS 254 chicken
AAI00223     245 ELLRKYVLAS 254 African clawed frog
XP_002592064 225 ELLRKFLMMS 234 Florida lancelet
XP_394741    703 ELLRKCKFVA 712 honey bee
XP_795790    334 ELLKRTVPQC 343 purple urchin
XP_001660245 226 ELLRKCKFVA 235 yellow fever mosquito
Q04688       263 QLLKECNFVS 272 fruit fly
XP_002428175 255 ELLRKCKFVA 264 human body louse
XP_002399675 220 ELLRKCKIVG 229 black-legged tick
XP_970323    291 ELLRKMKVVA 300 red flour beetle
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap