1ZSV,1V3V,1V3T


Conserved Protein Domain Family
leukotriene_B4_DH_like

?
cd08294: leukotriene_B4_DH_like 
Click on image for an interactive view with Cn3D
13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity
Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto- 13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.
Statistics
?
PSSM-Id: 176254
View PSSM: cd08294
Aligned: 22 rows
Threshold Bit Score: 418.59
Threshold Setting Gi: 260782292
Created: 2-Jun-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 26 residues -Click on image for an interactive view with Cn3D
Feature 1:NAD(P) binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                           #                            
1ZSV_A        22 SMTKTWTLKKHFVGy-PTNSDFELKTSel-pPLKn---GEVLLEALFLTVDPYMRVAAKRlk-eGDTMMGQQVAKVVESK 95  human
1V3V_B         6 VKAKSWTLKKHFQGk-PTQSDFELKTVel-pPLKn---GEVLLEALFLSVDPYMRIASKRlk-eGAVMMGQQVARVVESK 79  domestic guinea...
XP_001603755  32 TVAKKYVFSKHFSGe-PKPTDLKLVEEel-pAVKd---GEILAEAEYLSVDPYMRAYTVRlp-vGRTMIGSQVAKIVESK 105 jewel wasp
XP_969053      2 VKAQVYTVAKIFDGe-IKESDLKLHEEel-pALEd---GEYLAESLYLSVDPYMRAYAKGyt-iGQVMIGIQVAKIIESK 75  red flour beetle
ACO12769       2 PLNKIWVLKKKLVSgsPQEEHFLLNDEqtldLRK----GEILCRTLFLSVDPITRLYMTYamdpGDPFPGRQIARVVESR 77  salmon louse
AAT39740      11 VTAQRWIVMKPFDGc-PKLSDFAISLE----PLRklqsGEFRCKGLLWSVEPFARVMDVDln-sKPLVQSLQVAEVIESR 84  Trichinella spi...
XP_781982      4 TTGKRFVLAEAFDGd-VKETNFRLEATli-pAPNe---GEVLLEALYLTVDPYMRVWGVQe---GEPMVGEQVAKVIASR 75  purple urchin
XP_002169215   6 KLTKTWYYKNAFDGl-PKEDDFEMKVTdl-pTIAd---GEFLCENLYLSVDPYMRYFASHmt-pGQIMVGTGVSRVIESK 79  green hydra
XP_001944948   2 VIAKKFILEKPFNGa-PTEDNFKLLEEel-dELNk---GEILVEAIWLSVDPYIRPYSNHvs-pGTTVMGTQIAKIIKSN 75  pea aphid
XP_968762      1 MKAKTIILSKKFQGy-PQETNFKIVEEsl-pQLKd---GEFLAQAEFLSVDPYIRVFMKAv---GAPIIGEQVAKIIESK 72  red flour beetle
Feature 1                                                                     #   #              
1ZSV_A        96 NvALPKGTIVLASpGWTTHSISDGk-----------dLEKLLTewpd--tiplSLALGTVGMPGLTAYFGLLEICgVKGG 162 human
1V3V_B        80 NsAFPAGSIVLAQsGWTTHFISDGk-----------gLEKLLTewpd--klplSLALGTIGMPGLTAYFGLLEVCgVKGG 146 domestic guinea...
XP_001603755 106 NpNYPVGKRIVGYmGWRSHTVLNPekpaskdqimkdrPYIIPDlgd----lspSLALGVLGMPGNTAYFGFLEICaPKAG 181 jewel wasp
XP_969053     76 NpKFQVGDIVVGNfGWRSHTIVQEpnn--------yfAYLLPEigt----lstSLALGVLGAPGVAAYFGFLDICrPLEG 143 red flour beetle
ACO12769      78 HkDFPRGKLICGSlGWQAYSVIQPdvvqdmcghkiplVADLPSqleht-klpkTAALGILGIPGVTAYISLIHACkVSGG 156 salmon louse
AAT39740      85 NaAFSVGSIVIGYfGWCTDCVTNGqealck-ayhigdLHSLPL----------SASVGAFGLSGIAAYVGFVERCnPQLG 153 Trichinella spi...
XP_781982     76 DnNIAVGSLVQAQsGWTTHSVAKGs-----------dVTPVPTfssp--dwpkSLALGVLGMPGKTAYFGLLDSCrPKAG 142 purple urchin
XP_002169215  80 NeKYPVGTLLTAScGWTTHFVPKEidmq------hpmFKVVPVdlq-----epSLALGVLGLTGLTAYHGLFDICaPKSG 148 green hydra
XP_001944948  76 NqDYKFGQLVFCStGWRTFSIINPttlek---dgmptFYLLPDfgn----lspSLGLGVLGMPGNTALFGFLNICdPKPG 148 pea aphid
XP_968762     73 NsKYPLGEYVVGEfGWRTHTVASEkp---------gdFFNLPPrlvsfgdlpkSLALGALGMTGVTALYGLQLCE-PAAG 142 red flour beetle
Feature 1              #  ###                  ##   #               #                       ##   
1ZSV_A       163 ETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQK-LGFDVVFNYKTvesLEETLKKasPDGYDCYFDNVGGE 241 human
1V3V_B       147 ETVLVSAAAGAVGSVVGQIAKLKGCKVVGAAGSDEKIAYLKQ-IGFDAAFNYKTvnsLEEALKKasPDGYDCYFDNVGGE 225 domestic guinea...
XP_001603755 182 ETVVISGAAGAVGSHVGQIAKIHGLKAIGIAGSDSKCKWLVDeLGFDRAINYKTe-nIAAALKEaaPDGVDCYFDNVGGD 260 jewel wasp
XP_969053    144 DTVVVSGAAGAVGSHVGQIAKIKGCRVIGITGCEDKARWLES-LGFDYVINYKTtknLAEDLKVgaPKGIDCYFDNVGGD 222 red flour beetle
ACO12769     157 ETVVISSAAGQIGHIIGQIAKILGCRVVGYTGNSDKASWLKTeLGIDNVFNYKTq-eVETTLKIgaPYGVDIFIDSVGGA 235 salmon louse
AAT39740     154 NIVVVNAAAGGIGHLVCQMAMFYRCVLIAFVGSDEKVNWLKTfINAKFVYNYKTv-dVGKLLDEivPDGVDIFFDSVGGE 232 Trichinella spi...
XP_781982    143 ETVVVSGAAGAVGGVVGQIAKIKGCRVIGFAGSDKKVQYLKD-LGYDVAINYKTmgdLDMTLKKavPEGIDCYYDNVGGE 221 purple urchin
XP_002169215 149 ETVFVNTAAGAVGSIVGQLAKLKGCHVVGCTSSDDKVAYLKE-LGFDGAFNYNTe-nMKEKLKElcPKGIDCFFDNVGGS 226 green hydra
XP_001944948 149 ETVVISAAAGAVGIHVGQIARNLGCYVIGFAGSDHKVKWLKEvLKFDAAFNYKTk-dVNAALLEaaPHGVDCYFDNVGGD 227 pea aphid
XP_968762    143 KTLVVSGAAGAVGTHVGQLAKLQGCKVVGITGSDAKGHRLVKeLDFDAFVNYKSe-dFEKKLAEatPQNIDCYFDNVGGD 221 red flour beetle
Feature 1                         ##### #                             ###                        
1ZSV_A       242 FSNTVIGQMKKFGRIAICGAISTYNRtgplp--pgppPEIVIYQE---LRMEAFVVYRWqgdARQKALKDLLKWVLEGKI 316 human
1V3V_B       226 FLNTVLSQMKDFGKIAICGAISVYNRmdqlp--pgpsPESIIYKQ---LRIEGFIVYRWqgdVREKALRDLMKWVLEGKI 300 domestic guinea...
XP_001603755 261 ISTTVIYQMREFGRVSICGSISSYNSdslpk--trilQPAVVFNQ---LKMEGFIVTRWs-dRWLEGIEKNMQWIREGKL 334 jewel wasp
XP_969053    223 MSTTVMELMNQGGRVSVCGSISSYNAknpir--aaivQPAIVSKQ---LELKGFVSLQFr-dRWMEAIGQNLKWVQENKL 296 red flour beetle
ACO12769     236 FHSKIIDKMNLRGRICILGSLSMYDTpcqvp-svpamDMDVALKE---LTIMGFNIYRCw-dKVSEALDQLTDWCEEGQL 310 salmon louse
AAT39740     233 FANKVMVRMKKGGRMCLCGTISDYNEtkskkdscvraDYGLAKRRgfiIRPLSALALRS---RWPDIIPKVMELFCKGAM 309 Trichinella spi...
XP_781982    222 FSSTVLYNMNVRGRVCVCGSISAYNEkerpk--asivQPAINRQR---LTMQGMMVYDYt-dRFPEALKDMMQWIQEGKL 295 purple urchin
XP_002169215 227 QFDIALSEMNRHGRVALCGSISLYNEkemsqvkgpyvHLFAIHNE---LKIQGFMVFTLykdRFVEAFKEMHGYLTEGKI 303 green hydra
XP_001944948 228 FSSAVIYRMKNFGRVSVCGSISSYNTnpknlpkvsmlQPAIVFKQ---LKIEGFIVSRWa-dKWQSGIERNLNFIKEGKL 303 pea aphid
XP_968762    222 VSSAVLHRMNKFGHVVICGAISTYNDentk---arevQTPVKVNH---LVMEGFSVTRWr-nKWNKAIDDNLKLIQEGRL 294 red flour beetle
Feature 1                           ## # #        
1ZSV_A       317 QYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA 349 human
1V3V_B       301 QYHEHVTKGFENMPAAFIEMLNGANLGKAVVTA 333 domestic guinea pig
XP_001603755 335 KYKETVTEGFENMFQAFHGMLKGENVGKAVVKV 367 jewel wasp
XP_969053    297 KYRETITDGFENATKALIGVLKGENVGKAVVRT 329 red flour beetle
ACO12769     311 QVHEEMVEGIENVPNAFIDQLGGKYHGKLIVRI 343 salmon louse
AAT39740     310 RYREQRYMGFENLPQAFIDQLNGDTFGRVAVYA 342 Trichinella spiralis
XP_781982    296 KYREHVTNGFENTPKAFMELFSGDNFGKAIIKI 328 purple urchin
XP_002169215 304 SARDHVVEGFENMPKALIGLFHSVNVGKVVVKC 336 green hydra
XP_001944948 304 IYPEYIVQGFESLPQAFIGMLNGENLGKALVKV 336 pea aphid
XP_968762    295 KYFETVTEGFENTPDAFMKMLGGQNFGKAIVKV 327 red flour beetle

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap