1TT7,1XA0


Conserved Protein Domain Family
MDR_yhfp_like

?
cd08289: MDR_yhfp_like 
Click on image for an interactive view with Cn3D
Yhfp putative quinone oxidoreductases
yhfp putative quinone oxidoreductases (QOR). QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.
Statistics
?
PSSM-Id: 176249
View PSSM: cd08289
Aligned: 11 rows
Threshold Bit Score: 531.133
Threshold Setting Gi: 258510832
Created: 1-May-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
putative NADPputative dimer
Conserved site includes 27 residues -Click on image for an interactive view with Cn3D
Feature 1:putative NADP binding site [chemical binding site]
Evidence:
  • Comment:contacts defined by comparison to Yhdh

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                ##                                      
1TT7_A         5 FQALQAEKNAdd-vSVHVKTIsteDLPKDGVLIKVAYSGINYKDGLAGKagGNIVREYPLILGIDAAGTVVSSndPRFAE 83  Bacillus subtilis
1XA0_A         4 FQAFVVNKTEte-fTAGVQTIsxdDLPEGDVLVRVHYSSVNYKDGLASIpdGKIVKTXPFVPGIDLAGVVVSSqhPRFRE 82  Geobacillus ste...
NP_470109      4 FQALFIEKEAdn-tSLHFRETtldNLPENEVTIEVHYSGINYKDGLAVLpdGKIVKEYPFIPGIDASGVVVESksARFKA 82  Listeria innocu...
NP_691789      3 YKAFVLYKEEdr-lHHKIENVnedYWQEGDVWIDVAYSSINYKDAYVVKd-GSLAEKSPLIPGIDLAGIVRESnnPSFKK 80  Oceanobacillus ...
NP_765505      5 FKAFVVDQDDngivSNSYKELtkdDLPEGDVLIKVHYSGINYKDALATQdhNKIVKQYPMVPGIDLAGTIEETnaPGFEV 84  Staphylococcus ...
YP_001319535   5 FRALVVNKINed-fTVSINDLimeDLPEGEVTIRVAYSSVNYKDGLASIpeGQIVKSYPFIPGIDLVGTVVTStnSQYQK 83  Alkaliphilus me...
YP_002634961   5 FQAYFSNKIEgn-vTSSFKNLpidELNDGDVLVRVAYTSINFKDALAAAkgAGVVKEYPIIPGIDLAGTVVESnsSAHKP 83  Staphylococcus ...
YP_003013894   4 FRALVADNNGeeapKLAIKNLtiaDLPEGEVTVRVTYSSVNYKDGMVGIw-GRMIKSYPHIPGIDLSGTVAEStdPRYKP 82  Paenibacillus s...
YP_003184266   4 FRAHMVEQDGna-hRAGVRELtldQLPEGEVLIRVRYSSVNYKDGICSQpaSRLVTRYPMVLGIDLAGEVVESrdARFRP 82  Alicyclobacillu...
YP_003244130   7 FQAYVLRQDEqg-vRGSVENMrldQLPEGDVIVRVLYSGVNYKDGLASIpgGKIVRRYPFIPGIDLAGTVVHSahADYKE 85  Geobacillus sp....
YP_003321361   8 FRALYVEKDGdd-vSVDFRTLrpdDLPPGEVTIRVAYSSVNYKDGLAVIptGRVVRRYPMVPGIDLAGTVVESqdPRFQP 86  Sphaerobacter t...
Feature 1                                                      ##  #                       # ####
1TT7_A        84 GDEVIATSYELGVSRDGGLSEYASVPGDWLVPLPQNLSLKEAXVYGTAGFTAALSVHRLEQNGLSPEKGSVLVTGATGGV 163 Bacillus subtilis
1XA0_A        83 GDEVIATGYEIGVTHFGGYSEYARLHGEWLVPLPKGLTLKEAXAIGTAGFTAALSIHRLEEHGLTPERGPVLVTGATGGV 162 Geobacillus ste...
NP_470109     83 GDEVIVTSYDFGVSYSGGYSEIIRVPAEWVVALPKGLSLKEAMILGTAGFTAALSVDALEFSGVTPDAGKIAVSGATGGV 162 Listeria innocu...
NP_691789     81 GQEVIATSYRIGTGHHGGYAQLARVPSEWVIPLPDGLTLKEAMILGTAGLTAALSIQKLENNGLTPEQGPVVVPGATGGV 160 Oceanobacillus ...
NP_765505     85 GDKVIVTSYDLGVSHYGGFSEYARVKSEWVIELPEDLTLEEAMIYGTAGYTAGLAIEQLEKSGMSIEGKEVLVRGATGGV 164 Staphylococcus ...
YP_001319535  84 GDEVIVTSYGLGVSHYGGYSEYARVPAHWVVPLPKGLTMKEAMAFGTAGFTAALSVYKLEEAGLTPDQGPVLVTGATGGV 163 Alkaliphilus me...
YP_002634961  84 GDKVIVTSYDLGVSHHGGFSELAKVKEEWIVPLPKGLTLEEAMIYGTAGYTAALAIRKLEDNGLTVEGAPVLVRGASGGV 163 Staphylococcus ...
YP_003013894  83 GDEVIVTSYGLGVTHHGGYSELARVPASWVVPLPSGLTQREAMILGTAGFTAALSVQRLEDNGLTPEKGPVVVAGASGGV 162 Paenibacillus s...
YP_003184266  83 GDPVICTSYDLGTGHFGGFSEYARVPADWVVPLPDGLSLRDAMVLGTAGFTAALSLYRMEQNGVSPAMGAMLVTGATGGV 162 Alicyclobacillu...
YP_003244130  86 GDSVLCTGYELGVSHEGGFSQYARVKGEWLVPLPQGLSPRDAMAIGTAGFTAALSIEALLRNGLRQEQGSVLVTGATGGV 165 Geobacillus sp....
YP_003321361  87 GDEVLATSYEIGVSHFGGYSEYARIPAQWVLPLPEGLTTKEAMALGTAGLAAALSVHRLREHGVTPEQGPVLVTGATGGV 166 Sphaerobacter t...
Feature 1                          ###                 #                       ##                
1TT7_A       164 GGIAVSXLNKRGYdVVASTGNreAADYLKQLGASEVISRedvy--dgtlKALSKqQWQGAVDPVGGKQLASLLSKIqYGG 241 Bacillus subtilis
1XA0_A       163 GSLAVSXLAKRGYtVEASTGKaaEHDYLRVLGAKEVLARedvx--aeriRPLDKqRWAAAVDPVGGRTLATVLSRXrYGG 240 Geobacillus ste...
NP_470109    163 GSLSTAILAKRGYsVVASSGKkdAETFLHKLGAKEVVPReafq--pekiRALDKqLYAGAIDCVGGKPLSYLLTAVkYGG 240 Listeria innocu...
NP_691789    161 GSLAVNMLSNLGYeVIAGTGKedKKEYLLQIGASEVVNRqdlq--eeapSSPQKtKWAGAVDPVGGNTLSYILNTLkRGG 238 Oceanobacillus ...
NP_765505    165 GTISLLMLNNLGYdVIASTGRddAEEKLKKLGAKEVIGRlpe----dnsKPLEKrTWQAAIDPVGGENLPYIVKRLdNNG 240 Staphylococcus ...
YP_001319535 164 GSVAIAILAKKGYeVVASTGKasEHEYLKLLGAKKIISRselq--pekiRGLGTqMWAGAVDPVGGDTLAYILSTVnYGG 241 Alkaliphilus me...
YP_002634961 164 GSLAVMMLSNIGFkVVASTGNneAADYLKSLGAKEIVPRlee----tskKPLGKrEWQAVIDPVGGSHVGDVLKHLqIRG 239 Staphylococcus ...
YP_003013894 163 GSVAVNILAKRGYeVTASTGRlsEEAYLKELGAKHVIHRdelt--eserKPIRRpLWAAAVDPVGGKTLSYLLSTLqYGG 240 Paenibacillus s...
YP_003184266 163 GATGIAIAKRAGYrVVASTRKdeAAEWLKTLGADDVVRPdalllqegesYLNVKtRYAGVIDPVSGKYVPHLLQRLeYGG 242 Alicyclobacillu...
YP_003244130 166 GSFAVSILNQLGYrVTASTGKssQTDWLLKLGAHEVISReeaa--aaskGAISAeKWAAVVDPVGGDHLGAILKSVqYGG 243 Geobacillus sp....
YP_003321361 167 GSIAVSILAQLGYhVAASTGKatEHDYLRSLGAQEILPReets--aestRPLESqRWAGAVDPVGGATTAYLLRTTrYGG 244 Sphaerobacter t...
Feature 1            #####                    ####                                           #   
1TT7_A       242 SVAVSGLTGGGEVPATVYPFILRGVSLLGIDSVYCPxdVRAAVWERXSSDLKpd-qlLTIVDREVSLeeTPGALKDILQn 320 Bacillus subtilis
1XA0_A       241 AVAVSGLTGGAEVPTTVHPFILRGVSLLGIDSVYCPxdLRLRIWERLAGDLKp---dLERIAQEISLaeLPQALKRILRg 317 Geobacillus ste...
NP_470109    241 AVTTCGMSAGGKLDTTVFPFILRGIQLFGIDSVLCPmpKRERIWKRLATDFKlt--nLNELATEINFseLPAALHQIMNg 318 Listeria innocu...
NP_691789    239 SVATSGFTAGTDVQTTVFPFIGRGVNWLGIDSVTCSmeERTAAWHRLATDLKpt-ifQNESIQEVTLedLDQVFEAMLAg 317 Oceanobacillus ...
NP_765505    241 SVALIGMTGGNNFETTVFPFILRGASIIGIDSVFTPikLRKRVWRRLAKDLKpq--qLHDIKHVISFdeIPKAIDQVINh 318 Staphylococcus ...
YP_001319535 242 AVAVCGLTGGVKVPTTVFPFILRGIKLLGIDSVDCPmkIRKPLWQKMAGEMKpd-qlLSSIGQEVTLdeLPNILPGILKg 320 Alkaliphilus me...
YP_002634961 240 SVALIGNTDGVEFDATVLPFILRGNNLLGVDSVETPmlLRKQIWRRLATDLKpe--qLHTIKNIIDFkeLPEAIDNVLSh 317 Staphylococcus ...
YP_003013894 241 SVATSGLTGGVEVETSVYPFILRGVNWLGIDSVECPmeLRRRVWERLATDLKpt-mlSNTIVKEIQLeqLPEELALILQg 319 Paenibacillus s...
YP_003184266 243 VIAISGYTGGPDFTASVFPFLRRQAAIIGIDSVWLDmeTRREIWRRLAGPWKpsdeaLRQIGHDITLddLDSALKQILAg 322 Alicyclobacillu...
YP_003244130 244 SVAVSGMTGGGAFETTVFPFILRGINLLGIDSVYCPmaYRRALWTKLANEWKpt-svLQEGIGEYGLtdLPEVLNTILQg 322 Geobacillus sp....
YP_003321361 245 TVALCGVAGGAAVTTTVFPFILRGVTLAGVDTVECPmdLRREIWQHLATDWKpa-glLDPITQEIPFtdLPATLSAILHg 323 Sphaerobacter t...
Feature 1         #        
1TT7_A       321 RIQGRVIVKL 330 Bacillus subtilis
1XA0_A       318 ELRGRTVVRL 327 Geobacillus stearothermophilus
NP_470109    319 GITGRYLVKI 328 Listeria innocua Clip11262
NP_691789    318 RTTGRTIVAL 327 Oceanobacillus iheyensis HTE831
NP_765505    319 NNTGRIVIDF 328 Staphylococcus epidermidis ATCC 12228
YP_001319535 321 KTKGRLIVKI 330 Alkaliphilus metalliredigens QYMF
YP_002634961 318 QVTGRYVVKV 327 Staphylococcus carnosus subsp. carnosus TM300
YP_003013894 320 QVRGRTIVRL 329 Paenibacillus sp. JDR-2
YP_003184266 323 RMQGRAVVNL 332 Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
YP_003244130 323 GAVGRSVIAL 332 Geobacillus sp. Y412MC10
YP_003321361 324 QVRGRVVVRM 333 Sphaerobacter thermophilus DSM 20745

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap