Conserved Protein Domain Family
FDH_like_ADH2

?
cd08286: FDH_like_ADH2 
formaldehyde dehydrogenase (FDH)-like
This group is related to formaldehyde dehydrogenase (FDH), which is a member of the zinc-dependent/medium chain alcohol dehydrogenase family. This family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Another member is identified as a dihydroxyacetone reductase. Like the zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), tetrameric FDHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains and a structural zinc in a lobe of the catalytic domain. Unlike ADH, where NAD(P)(H) acts as a cofactor, NADH in FDH is a tightly bound redox cofactor (similar to nicotinamide proteins). The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.
Statistics
?
PSSM-Id: 176246
View PSSM: cd08286
Aligned: 27 rows
Threshold Bit Score: 521.041
Threshold Setting Gi: 115399088
Created: 14-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:NAD(P) binding site [chemical binding site]
Evidence:
  • Comment:defined by comparison to related dehydrogenases

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
YP_001834698   1 MKALVYRGPGQKLVEERQKPELKEPGDAIVKVTKTTICGTDLHILKGDVATCKPGRVLGHEGVGVIESVGSGVTAFQPGD 80  Beijerinckia in...
NP_624515      1 MKGYVFHGPGRSAWEDIPDPELKEPTDAIVRVDAVTICGTDLHILKGDVPEVRPGTVLGHEAVGEIVEVGTDVRTVRPGD 80  Streptomyces co...
YP_645795      1 MKALVYHGPGEKSWESKEDPRIERPTDAVVRIDTTTICGTDLHILKGDVPEVAEGRTLGHEAVGTVVDAGPGVENFEEGD 80  Rubrobacter xyl...
EED79914       1 MKAVIYVGLGKVEIQERPMPKILEPTDAIVKLSKTTLCGTDLHILKGDVPTVSFGRIMGHEGVGTIEAVGPAVSAFAPGD 80  Postia placenta...
CAP95943       1 MKAVIYTGDNKIVVEDRAKPVILEPTDAIVRVLHTTICGTDLHILQGHVPSCTPGRIIGHEGVGIIETLGAAVTNLTVGQ 80  Penicillium chr...
XP_001209748   1 MKALVYNGPQKLGVEDRPKPELKESTDAIVRVLHTSICGTDLHILKGDVPTVDEGRILGHEAVGVVESMGSAVSGLQTGD 80  Aspergillus ter...
XP_001239087  68 MKALVYAGNGKVALEERPKPTLSSPTDAIVKLKYGTICGTDLHIIKGDVPTATPGRILGHEGVGIIEEVGSNVTGLSKGD 147 Coccidioides im...
XP_001539616  36 VLPILQVLVFVPPAPDRPQPSIQSATDAIVKLKYTTICGTDLHIIKGHVQSATPGRVLGHEGVGVIHEVGSSVQGLVPGD 115 Ajellomyces cap...
XP_001822319  27 MKALVYTGPNKLEVLDRPMPVIQSPTDAILKMLHSTICGTDLHILKGDVPAIPYDRVLGHEGVGTVVSVGPAIDGLSVGD 106 Aspergillus ory...
XP_001215133  14 MKAVIFKEIGTIEAVDRPKPQIQHPTDAIVKVLHTSICGTDLHIMRGHVPTCVPGRILGHEGVGVVDALGSGVSNLQVGD 93  Aspergillus ter...
Feature 1                                                                             #   #      
YP_001834698  81 RVLISCISSCGKCSFCRRGMFSHCTTG-GWILGNEIDGTQAEYVRVPHADtSLYRIPAgaDEEALVMLSDILPTGFECGV 159 Beijerinckia in...
NP_624515     81 RVLVSCITACGRCRYCREGVYGQCLGGgGWILGHLINGTQAEYVRVPYADlSVHSLPGavTDEDAVLLADIFPTAYEVGV 160 Streptomyces co...
YP_645795     81 RVLVSCISACGRCAYCRRGMYGQCLQGgGWILGHLVDGTQAEFARIPFADnSLYEVPEglSDEQVVFISDILPTGYEVGV 160 Rubrobacter xyl...
EED79914      81 RVVISSVSKCGLCTFCRRGIFSHCARG-GWQLGNTLDGTQAEFVRIPYADgSLHRASPavPDAALLMLSDAVPTGLECGT 159 Postia placenta...
CAP95943      81 MVIISCITSCGTCHYCRKKMPSQCESG-GWILGNKIDGTQAEYVRIPHAPlSLHALPEsiDQKVAVTLSDTVPTSYECGI 159 Penicillium chr...
XP_001209748  81 KVLISCVSACGVCGPCRKGLSSHCAYG-GWILGNTIDGTQAEYVRIPHATsSLFKLSDkiDVRTAVVLSDAFPTALECGT 159 Aspergillus ter...
XP_001239087 148 TVLIACITACGSCSFCRKGMSSHCSHG-GWILGNTIDGTQAEYVRIPCAMsSLYKLPPtvDLAEAVMLSDALPTGFECGT 226 Coccidioides im...
XP_001539616 116 TVLISCISACSVCGFCRKGMPSHCVSG-GWVLGNHIDGTQAEFVRIPHASsSLYKLPAtvDLTAAVMLSDALPTGLECGT 194 Ajellomyces cap...
XP_001822319 107 NVVIAAITACKVCASCRKGLEAHCITG-GWQLGNKVDGTQAEYVRIPHATsSLYKIPEglDLRACAAISDALPTGLECGT 185 Aspergillus ory...
XP_001215133  94 CVLISCISACGTCKRCRAGMTSHCTTG-GWILGHTIDGTQAEYVRVPHAGfSLYVLPPsvDAQAAVALSDAFPTAYECAI 172 Aspergillus ter...
Feature 1                      # ###                    ##   #                                   
YP_001834698 160 LNGKvaPGSSVAIVGAGPVGLAALLTAQFYSp-AEIIMIDLddNRLGLAKQFGATRTVNSTggn--aaAEVKALTEGl-G 235 Beijerinckia in...
NP_624515    161 LNGRvsPGDTVVVVGAGPIGLAAVATARLFAp-ERIVVVDLatARLEAARKLGAEAVADARed---peQLVADLTGGl-G 235 Streptomyces co...
YP_645795    161 LNGKvePGDTVAIVGAGPIGLASMLTARLYGp-SRIIAIDLadSRLEQARRFGADTTINNSaqd--avEMVMELTGGl-G 236 Rubrobacter xyl...
EED79914     160 LDARvrPGCSVAIVGAGPVGLCALMTARLYSp-AMVIVLDLdsARLEVARRLGATHVVRAGtg---avEEVMRLTGGe-G 234 Postia placenta...
CAP95943     160 LNGGiqPGSTVAIIGTGPIGLMILQMARNLFgpSMTAVVGRgaPRLETAKSMGADHTFSMLdgqdavvSSALAVTKEr-G 238 Penicillium chr...
XP_001209748 160 LSAHvqPGNTVAIIGAGPVGMAALLTAKLYSp-SLIVMVDTndARLKKAKELGAHETVNSAqtd--akSALNALTDGr-G 235 Aspergillus ter...
XP_001239087 227 LNSKvrPGSSVAIVGAGPVGLAAMKTAQLYSp-AKLVLVDLddSRLQVGQKLGATHGVNPKgqd--giKRLLDLTPNgqG 303 Coccidioides im...
XP_001539616 195 LDGKvsPGSTVVIIGAGAVGMSVMMTSLLYSp-SLLVIVDLddGRLSMAKQLGAHATVNSRnse-eamDKLLKMTNGe-G 271 Ajellomyces cap...
XP_001822319 186 ISAHvqPGSTVAIIGAGPVGLAVMLTARLYTp-SQIVMIDLddTRLEHAKRLGADHAVNPGkld--amETLNTFTEGq-G 261 Aspergillus ory...
XP_001215133 173 LPGNlrPGCTIAVVGAGPVGLAVLVLAKKLFapRNVVLVGKgeHRLQAGRTLGADHALSSAlgneqiiEQALAVNDGe-G 251 Aspergillus ter...
Feature 1                    #                # #                       #                        
YP_001834698 236 VDTAIEAVGIPATFELCQNIVAPGGTIANVGVHGs--kVDLHLESLWSHNVTITTRLVDtaTTPMLLKTVQSHk-LDPSR 312 Beijerinckia in...
NP_624515    236 ADVVIEAVGVPETFEMCTRVVRPGGHVANVGVHGr--pATLHLEDLWSKNVTVTTGLVDtrSTPTLLRMAASGr-LPTGQ 312 Streptomyces co...
YP_645795    237 ADVVMEAVGVPATFELCTGLVRPGGHVANIGVHGa--pATLHLERLWARDVTITTGLVDtySTPTLLRLVAEGr-LDPTP 313 Rubrobacter xyl...
EED79914     235 VDAVIEAVGVPASFELCQELVAVGGTIANLGVHGa--sATIHLEKLWNRNITVTTRQVDngSTADLMELIARGq-IDAGA 311 Postia placenta...
CAP95943     239 FDVVIEAVGTPESFETAQALVGAGGTIASLGVFGe--sCELHLEKLWNRNICLRTRLIDaiSTPDLLKMVEAGg-IDPNF 315 Penicillium chr...
XP_001209748 236 FDSVIEAVGIPATFELCQGIIGVGGSVANVGVHGk--pVTLHMERLWDRNINIRASLVDatTTPMLLRLFDAGq-IDARP 312 Aspergillus ter...
XP_001239087 304 FDAVMEAVGIPATFQLCQEIVGPGGVIANIGVHGt--kVDLHLEKLWSQNISITTRLVDatTIPELLTLFEAKt-LNVSD 380 Coccidioides im...
XP_001539616 272 FDCVVEAVGTPHTFQFCQSLVAPGGSIANVGVHGt--kVELYMDKLWNRNICISTRLVDavTTPMLLKLFTAGk-LDTAK 348 Ajellomyces cap...
XP_001822319 262 FDCVIEAVGIPKTFEMCQKLVAPGGSIANVGVHGh--pVNLDLHKLWDRNISIKMQLLNavSIPTLLRLYQSGh-IKPSN 338 Aspergillus ory...
XP_001215133 252 FDVVVECVGIPETFDLCQKLLGLGITSRLVDTTTlgdlVNLVQKEKIDPGLLISHRFAFs-DIMRAYDTFKAGssRDVLK 330 Aspergillus ter...
Feature 1                           #               
YP_001834698 313 LITHRFSL--DQILDAYETFGQAastqALKVIISM 345 Beijerinckia indica subsp. indica ATCC 9039
NP_624515    313 LVTHTFPL--ERMEEAYEVFSAAadtgALKVVLGG 345 Streptomyces coelicolor A3(2)
YP_645795    314 FATHRFAL--GEILDAYETFADAartqALKVVLSA 346 Rubrobacter xylanophilus DSM 9941
EED79914     312 LATHYFRF--DEIQEAYACFSNAaankALKVIVDF 344 Postia placenta Mad-698-R
CAP95943     316 LVSHSFAF--DDIHNAYEAFEASskhgALKVVVTM 348 Penicillium chrysogenum Wisconsin 54-1255
XP_001209748 313 LITHVFPF--NDVIKAYATSKEAakeeAMKIVIDI 345 Aspergillus terreus NIH2624
XP_001239087 381 FITHRYKF--ADCVKAYDTFKAAaqhqALKVSLEF 413 Coccidioides immitis RS
XP_001539616 349 LITHRFKF--KDCTQAYKTFGAAaehnALRVLLSM 381 Ajellomyces capsulatus NAm1
XP_001822319 339 LFTHHYPF--SEVHKAYHSFQMAaqegALKVAIDF 371 Aspergillus oryzae RIB40
XP_001215133 331 VVITTVTTmfNTTDESSPGYYGAt--kTALLLLDF 363 Aspergillus terreus NIH2624

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap