Conserved Protein Domain Family
sorbose_phosphate_red

?
cd08238: sorbose_phosphate_red 
L-sorbose-1-phosphate reductase
L-sorbose-1-phosphate reductase, a member of the MDR family, catalyzes the NADPH-dependent conversion of l-sorbose 1-phosphate to d-glucitol 6-phosphate in the metabolism of L-sorbose to (also converts d-fructose 1-phosphate to d-mannitol 6-phosphate). The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of an beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability.
Statistics
?
PSSM-Id: 176200
View PSSM: cd08238
Aligned: 7 rows
Threshold Bit Score: 570.92
Threshold Setting Gi: 224367980
Created: 19-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative NAD(P)catalytic Zn
Feature 1:putative NAD(P) binding site [chemical binding site]
Evidence:
  • Comment:MDR family binds NAD(P) as a cofactor
  • Comment:defined by comparison to MDR alcohol dehydrogenase like family

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                    ###  #                              
P37084         2 QTTTALRLYGKRDLRLETFTLP------AMQDDEILARVVTDSLCLSSWKEANQGADHKKVPDD-VATRPIIIGHEFCGE 74  Klebsiella pneu...
P52048         1 MKTKVAAIYGKRDVRLRVFELP------EITDNELLVSVISDSVCLSTWKAALLGSEHKRVPDD-LENHPVITGHECAGV 73  Escherichia col...
YP_002250187   1 METIALRMYGKMDLRLEKFELP------QIKEDEILAEIISDTSCPSTYKEILQGPDHPRVPKD-VDKNPVIVGHEMAGV 73  Dictyoglomus th...
YP_002572587   1 MKTKAVRLYGKNDLRLEEFELP------PIREDEILAKVISDSLCMSSYKAAIQGSDHKRVPKD-IDKNPVIIGHEFCGQ 73  Anaerocellum th...
YP_001544301  16 ATTVAWNMYGAGVEHIGRNAQPetfavtEPAADQLLVRVDAVGMCFSDVKLIQQGGRHPKLYNRdLATEPTRLGHEAALT 95  Herpetosiphon a...
YP_002602143  17 EQTLVWNMYGAGEENIGKNGKPellpipKPAANQMLVRVDSVGLCFSDVKLIRMGRKHPKLYNRdLTKEPTRLGHEASLT 96  Desulfobacteriu...
YP_003308782   1 MKTKAVRLYGKNDLRLEEFELP------EINDDEILMSVVTDSICMSTWKLAKQGEDHKKTPEN-IKEKPIIVGHEFCGE 73  Sebaldella term...
Feature 1                                                                                        
P37084        75 ILAVGKKWQHKFQPGQRYVIQAn-lQLPDRPDc---PGYSFPWIGGEATHVVIPNEVMAQD----CLLTWEGDTWFEGSL 146 Klebsiella pneu...
P52048        74 IVEVGKNLTGKYKKGQRFVLQPa-mGLPSGYS----AGYSYEYFGGNATYMIIPEIAINLG----CVLPYHGSYFAAASL 144 Escherichia col...
YP_002250187  74 ILKVGSKWKGKYEEGQKFTIQPallYEKGPVGvlsaPGYSYKYLGGLATKVIIPNEVMEQD----CLLIYEGDAFYKASL 149 Dictyoglomus th...
YP_002572587  74 IVEVGKKWQDKFKPGDKFTVQPa-lNLKDNPYa--aPGYSFQYIGGDATYIIIPNEVMEQN----CLLKYKGDAFFYGSL 146 Anaerocellum th...
YP_001544301  96 VLKVGAHLQNQYQPGQRLAIQPd--IYQDGMS----TAYGYTIPGGLTQFHLIGAEVLNADdgayVLPVGEGMGYAETAL 169 Herpetosiphon a...
YP_002602143  97 IIEVGEELKGKYYPGQRVAVQPd--IYQNGKS----TAYGYTIPGGLIQYHLIGPEMLETDegacLLPITGDMGYAEASL 170 Desulfobacteriu...
YP_003308782  74 VIKVGKNWGNKYKESERYVVQAn-lQLPDAPWc---PGYSYQYCGGDATYIILPADVMKQD----CLLPYNGETYFEGSL 145 Sebaldella term...
Feature 1         #   #                                                                          
P37084       147 VEPLSCVIGAFNANYHLQe------------------------------------------------------------- 165 Klebsiella pneu...
P52048       145 AEPMCCIIGAYHANYHTTq------------------------------------------------------------- 163 Escherichia col...
YP_002250187 150 VEPLSCVVGAVNAQYHTKe------------------------------------------------------------- 168 Dictyoglomus th...
YP_002572587 147 AEPMSCIIGAFHASYHTQp------------------------------------------------------------- 165 Anaerocellum th...
YP_001544301 170 TEPWACVEGAYTQRRRLNpkeggtlwiigqtgdqrsysfssgfdapariiltdvpqqlqqqlqqtskaqiivrdglsvdd 249 Herpetosiphon a...
YP_002602143 171 LEPWGCVLASYTQRRRLDpkdggvmwvigrpgdgreyeftkglaapatiiltdvpgtvakltdktsatvvvrnklgpdqy 250 Desulfobacteriu...
YP_003308782 146 IEPLSCVIGAFKGNYHLIe------------------------------------------------------------- 164 Sebaldella term...
Feature 1                                                                                        
P37084       166 -------------------------------------------------------------------------------g 166 Klebsiella pneu...
P52048       164 -------------------------------------------------------------------------------y 164 Escherichia col...
YP_002250187 169 -------------------------------------------------------------------------------n 169 Dictyoglomus th...
YP_002572587 166 -------------------------------------------------------------------------------g 166 Anaerocellum th...
YP_001544301 250 ylelrndltsnqgfddvvmldprsasqvsaaaglvarrgtfnlvgqtaldglpeidvgrihydyiayvgtnnsdisaayg 329 Herpetosiphon a...
YP_002602143 251 salaeeftd-gkgfddivmldprsgetvsavakfimrrgtlnlvgqtpldslvnadvgrlhydyiafigcqgpdigasyg 329 Desulfobacteriu...
YP_003308782 165 -------------------------------------------------------------------------------g 165 Sebaldella term...
Feature 1                          ######                    ##   #                        #     
P37084       167 SYNHVMGIRPQGHTLILGGTGPMGLLAIDYALHGPINPSLLVVTDTNKPKLSYARRHYPSEp----QTLIHYLDGheas- 241 Klebsiella pneu...
P52048       165 VYEHRMGVKPGGNIALLACAGPMGIGAIDYAINGGIQPSRVVVVDIDDKRLAQVQKLLPVElaaskGIELVYVNTkgmsd 244 Escherichia col...
YP_002250187 170 SYEHIMGIKRGGKTAILGGAGPMGLAFLAYLIYGPQNPSLLVITDIDDMKLQRAMRAFPKEevnkrGIDIRFVNP----- 244 Dictyoglomus th...
YP_002572587 167 KYIHRMGTLENGFMAILAGAGPMGLGAIDYAVHGPKPPKLLVVTDINQERLDRAASIYTQEdakkyGVDLYYVNTanidd 246 Anaerocellum th...
YP_001544301 330 EARNRCDLQPNGVAVFVGAGGPMGQMHVQRAIELPNGPRTIIATDVNDDRLRALDRLFRGLae-srGKRLLLINPtvens 408 Herpetosiphon a...
YP_002602143 330 EQRNRCELKAGGTTVFVGAGGPMGQMHVQRAIELPHGPGRVIATEVSDLRLAALQERFGPLaa-rnNCELLTFNPqtndk 408 Desulfobacteriu...
YP_003308782 166 TYDHKMGIKEGGNLLISGGTGPMGLLAIDYALHGDIKPKNIVITDVNEERLKRASELYKTEg----AVKVHYVNTakidd 241 Sebaldella term...
Feature 1                             ## #                   ##                         ###      
P37084       242 --rdtLLALSGGh-GFDDIFVFVPNEqLITLASSLLApDGCLNFFAGPQDKQFSAPINFYDVHYAFTHYVGTSGGNTDDM 318 Klebsiella pneu...
P52048       245 -pvqmLRALTGDa-GFDDIFVYAAVPaVVEMADELLAeDGCLNFFAGPTDKNFKVPFNFYNVHYNSTHVVGTSGGSTDDM 322 Escherichia col...
YP_002250187 245 -----TKDQSYKdiRYDDIFVLYPSPkLVEEADSLLArDGCLNFFAGPTDHNFTACVNFYKVHYDKHHFVATSGGNADDM 319 Dictyoglomus th...
YP_002572587 247 -venyLLSFTDGr-GFDDVFVFAPVReLVELADKILArDGCLNFFAGPSDPNFSALLNFYNVHYNSTHVVGTSGGNTDDM 324 Anaerocellum th...
YP_001544301 409 -lhatVMLETDDl-GADDVIVSVPSGpLMGDAATLMA-PNGMLVLFAGVPNGTFAPLNLSNVYLANAQFTGTSGSRIIDQ 485 Herpetosiphon a...
YP_002602143 409 slhdfVMEATNGq-GAEDVVVSVPIAdVMAEAGTLMH-KDGMLVFFAGVPNGTMAHLNLSAVYMGNAQYTGTSGLSLNDQ 486 Desulfobacteriu...
YP_003308782 242 -vvahLKETAGG--GYDDVFIFAPVPeLVTQGSKILNpDGCLNFFAGPQNKDFSAEINFYDIHYNFTHYVGTSGGNTDDM 318 Sebaldella term...
Feature 1                                                                                        
P37084       319 RAAVALMQAKKVQTAKVVTHILGLNAAGETTLDLP-AVGGGKKLVYTGKA-FPLTPLGEIADPELa-------------a 383 Klebsiella pneu...
P52048       323 KEAIALSATGQLQPSFMVTHIGGLDAVPETVLNLP-DIPGGKKLIYNGVT-MPLTAIADFAEKGKtdplf-----kelar 395 Escherichia col...
YP_002250187 320 KIALDLVQRKIIDPSPMITHVGGLNVAKDVLLNFP-NIPGGKKLIYTHIR-FPLSEIEDFERLSVegpkelrdiyrdlaq 397 Dictyoglomus th...
YP_002572587 325 IEALDLMAKGIVNPAAMITHIGGLNCVAQTTLNLP-KIPGGKKLIYTNIE-LDLVAIEDFKEKGKeeplf-----aelak 397 Anaerocellum th...
YP_001544301 486 ATVIQKTVAGELSPNRSVAAVGGIEAALDGVKAMMaGTYAGKVVIFPQLSgLPLTGIDELHKNFPev------------a 553 Herpetosiphon a...
YP_002602143 487 FQVMDQAAKGTLNPGRSVGAIGGMNVAREGIQAMIdGRYAGKIIIFPQFPdLPLMGLDELQDIYPdi------------a 554 Desulfobacteriu...
YP_003308782 319 REAIKLIEDKKVNVAKVVTHILGLDAVAETTLNQP-EIAGGKKVVYTQKK-FMLESLEKLMQDENsel----------gk 386 Sebaldella term...
Feature 1                            
P37084       384 IVARHHGIWSQEAEAYLLAH 403 Klebsiella pneumoniae
P52048       396 LVEETHGIWNEQAEKYLLAQ 415 Escherichia coli K-12
YP_002250187 398 IVRSNNGWWCKEAEEYLLTR 417 Dictyoglomus thermophilum H-6-12
YP_002572587 398 IVERNNGLWCKEAEDFLLEN 417 Anaerocellum thermophilum DSM 6725
YP_001544301 554 AKLGEGNVWNPEAEQALIET 573 Herpetosiphon aurantiacus ATCC 23779
YP_002602143 555 EKLEPGNMWTAEAEEALFEK 574 Desulfobacterium autotrophicum HRM2
YP_003308782 387 ILKKNDGIWSKEAEDYIMKN 406 Sebaldella termitidis ATCC 33386

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap