1SVD,4RUB,1IWA,1BXN,1RSC,1GK8


Conserved Protein Domain Family
RuBisCO_large_I

?
cd08212: RuBisCO_large_I 
Click on image for an interactive view with Cn3D
Ribulose bisphosphate carboxylase large chain, Form I
Ribulose bisphosphate carboxylase (Rubisco) plays an important role in the Calvin reductive pentose phosphate pathway. It catalyzes the primary CO2 fixation step. Rubisco is activated by carbamylation of an active site lysine, stabilized by a divalent cation, which then catalyzes the proton abstraction from the substrate ribulose 1,5 bisphosphate (RuBP) and leads to the formation of two molecules of 3-phosphoglycerate. Members of the Rubisco family can be divided into 4 subgroups, Form I-IV , which differ in their taxonomic distribution and subunit composition. Form I is the most abundant class, present in plants, algae, and bacteria, and forms large complexes composed of 8 large and 8 small subunits.
Statistics
?
PSSM-Id: 173977
View PSSM: cd08212
Aligned: 18 rows
Threshold Bit Score: 870.206
Threshold Setting Gi: 66360129
Created: 7-Jan-2010
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 19 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Structure:4RUB, Nicotiana tabacum ribulose-1,5-bisphosphate carboxylase/oxygenase with bound magnesium and transition analog , contacts 4A
    View structure with Cn3D
  • Citation:PMID 3681999

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                          #    ##                                    
1SVD_A     16 TYWMPEYTPLDSDILACFKITPQPGVDREEAAAAVAAESSTGTWTTVWTDlLTDMDYYKGRAYRIEDVPgddaAFYAFIA 95  Halothiobacillus n...
4RUB_A     23 TYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDgLTSLDRYKGRCYRIERVVgekdQYIAYVA 102 common tobacco
1IWA_A     32 GYWNPDYQVKDTDVLALFRVTPQPGVDPIEAAAAVAGESSTATWTVVWTDlLTAADLYRAKAYKVDQVPnnpeQYFAYIA 111 Galdieria partita
1BXN_A     25 GYWDGDYVPKDTDLLALFRITPQDGVDPVEAAAAVAGESSTATWTVVWTDrLTACDMYRAKAYRVDPVPnnpeQFFCYVA 104 Cupriavidus necator
P14957     27 GYWDADYVIKDTDVLAMFRMTPQKGVDPVECAAAIAGESSTATWTVVWTDlLTACDLYRAKAYRVDPVPgatdQYFAYIA 106 Guillardia theta
P27997     25 GYWDGDYVPKDTDVLALFRITPQEGVDPVEAAAAVAGESSTATWTVVWTDrLTACDSYRAKAYRVEPVPgtpgQYFCYVA 104 Rhodobacter sphaer...
P00878     23 TYYTPDYQVSETDILAAFRMTPQPGVPAEECGAAVAAESSTGTWTTVWTDgLTQLDRYKGRCYDLEPVPgesnQYIAYVA 102 Euglena gracilis
Q0P3J3     23 TYYTPDYQVKETDILAAFRMTPQPGVPAEECGAAVAAESSTGTWTTVWTDgLTQLDRYKGRCYDLEPVPgednQFIAYVA 102 Ostreococcus tauri
A0T0N6     27 GYWDAAYTVKDTDVLALFRITPQPGVDPVEAAAAVAGESSTATWTVVWTDlLTACERYRAKAYRVDPVPsatdQYFAFIA 106 Thalassiosira pseu...
B3DVG5     27 GYYNADYVPKDTDILAAFRFVPQEGVEPIEAGAAVAGESSTATWTVVWTDrLTAYEHYQGKCFRVEPVPgt-nQYIAFIA 105 Methylokorus infer...
Feature 1                         #                                                 # # #     
1SVD_A     96 YPIDLFEEGSVVNVFTSLVGNVFGFKaVRGLRLEDVRFPLAYVKTCgGPPHGIQVERDKMNKYGRPLLGCTIKPKLGLSA 175 Halothiobacillus n...
4RUB_A    103 YPLDLFEEGSVTNMFTSIVGNVFGFKaLRALRLEDLRIPPAYVKTFqGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSA 182 common tobacco
1IWA_A    112 YELDLFEEGSIANLTASIIGNVFGFKaVKALRLEDMRLPLAYLKTFqGPATGVILERERLDKFGRPLLGCTTKPKLGLSG 191 Galdieria partita
1BXN_A    105 YDLSLFEEGSIANLTASIIGNVFSFKpIKAARLEDMRFPVAYVKTFaGPSTGIIVERERLDKFGRPLLGATTKPKLGLSG 184 Cupriavidus necator
P14957    107 YELDLFEEGSLANLTASIIGNVFGFKaVNALRLEDMRLPIAYLKTFqGPATGVIVERERLDKYGRPLLGATVKPKLGLSG 186 Guillardia theta
P27997    105 YDLILFEEGSIANLTASIIGNVFSFKpLKAARLEDMRFPVAYVKTYkGPPTGIVGERERLDKFGKPLLGATTKPKLGLSG 184 Rhodobacter sphaer...
P00878    103 YPIDLFEEGSVTNLLTSIVGNVFGFKaLRALRLEDLRIPPAYSKTFwGPPHGIQVERDRLNKYGRPLLGCTIKPKLGLSA 182 Euglena gracilis
Q0P3J3    103 YPLDLFEEGSVTNLFTSIVGNVFGFKaLRALRLEDLRIPVAYCKTFqGAPHGIQTERDKLNKYGRGLLGCTIKPKLGLSA 182 Ostreococcus tauri
A0T0N6    107 YECDLFEEASLSNLTASIIGNVFGFKaISALRLEDMRIPHSYLKTFqGPATGIVVERERLNKYGTPLLGATVKPKLGLSG 186 Thalassiosira pseu...
B3DVG5    106 YDLDLFEEGSIANMSSSIIGNVFGFKaLKSLRLEDLRIPPHYVKTFqGPAHGIMMEREYLNKYGRPLLGATVKPKLGLSA 185 Methylokorus infer...
Feature 1                         ##                                                          
1SVD_A    176 KNYGRAVYECLRGGLDFTKDDENINSQPFMRWRDRFLFVQDATETAEAQTGERKGHYLNVTAPTPEEMYKRAEFAKEIGa 255 Halothiobacillus n...
4RUB_A    183 KNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALYKAQAETGEIKGHYLNATAGTCEEMIKRAVFARELGv 262 common tobacco
1IWA_A    192 KNYGRVVYEALKGGLDFVKDDENINSQPFMRWRERYLFTMEAVNKASAATGEVKGHYLNVTAATMEEMYARANFAKELGs 271 Galdieria partita
1BXN_A    185 RNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRFLFVMDAVNKASAATGEVKGSYLNVTAGTMEEMYRRAEFAKSLGs 264 Cupriavidus necator
P14957    187 KNYGRVVYEGLKGGLDFLKDDENINSQPFMRWKERFLFGIEGVNRAAAAAGEVKGHYFNVTAGTMEDMYERAEFCKEIGs 266 Guillardia theta
P27997    185 KNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRFLYVMEAVNLASAQTGEVKGHYLNITAGTMEEMYRRAEFAKSLGs 264 Rhodobacter sphaer...
P00878    183 KNYGRAVYECLRGGLDFTKDDENVNSQSFMRWRDRFLFCAEAIYKAQTETGEVKGHYLNATAGTCEEMYKRASFAAQIGv 262 Euglena gracilis
Q0P3J3    183 KNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFVAEAIYKSQAETGEIKGHYLNATAGNVDQMLKRAQVAKELGm 262 Ostreococcus tauri
A0T0N6    187 KNYGRVVYEGLKGGLDFLKDDENINSQPFMRWRERFLNCLEGINRASAATGEVKGSYLNITAATMEEVYKRAEYAKMIGs 266 Thalassiosira pseu...
B3DVG5    186 KNYGRVVYEALRGGLDFTKDDENINSQPFMRWRDRWLFCMEAVNKAMAETGEIKGHYLNVTAATMEEMYERAEFAKELGs 265 Methylokorus infer...
Feature 1                                    ##                               #      ##       
1SVD_A    256 PIIMHDYITgGFTANTGLAKWCQDNgVLLHIHRAMHAVIDRNPNHGIHFRVLTKILRLSGGDHLHTGTVVGKLEGdraST 335 Halothiobacillus n...
4RUB_A    263 PIVMHDYLTgGFTANTSLAHYCRDNgLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGerdIT 342 common tobacco
1IWA_A    272 VIIMIDLVI-GYTAIQTMAKWARDNdMILHLHRAGNSTYSRQKNHGMNFRVICKWMRMAGVDHIHAGTVVGKLEGdpiIT 350 Galdieria partita
1BXN_A    265 VIIMVDLIV-GWTCIQSMSNWCRQNdMILHLHRAGHGTYTRQKNHGVSFRVIAKWLRLAGVDHMHTGTAVGKLEGdplTV 343 Cupriavidus necator
P14957    267 VICMIDLVI-GYTAIQSMAIWARKNsMILHLHRAGNSTYSRQKTHGMNFRVICKWMRMAGVDHIHAGTVVGKLEGdplMV 345 Guillardia theta
P27997    265 VIVMVDLII-GYTAIQSISEWCRQNdMILHMHRAGHGTYTRQKNHGISFRVIAKWLRLAGVDHLHCGTAVGKLEGdplTV 343 Rhodobacter sphaer...
P00878    263 PIIMHDYLTgGFTANTSLAMYCRDNgLLLHIHRAMHAVIDRQRNHGIHFRVLAKTLRMSGGDHLHSGTVVGKLEGereVT 342 Euglena gracilis
Q0P3J3    263 PIIMHDYLTaGFTANTTLATYCREEgLLLHIHRAMHAVIDRQRNHGIHFRVLAKALRLSGGDHLHSGTVVGKLEGernVT 342 Ostreococcus tauri
A0T0N6    267 VIVMIDLVM-GYTAIQSIAYWARENdMLLHLHRAGNSTYARQKNHGINFRVICKWMRMSGVDHIHAGTVVGKLEGdplMI 345 Thalassiosira pseu...
B3DVG5    266 VIIMVDLTA-GFTAIQSMAKWCRKNgVLLHLHRAGHSTYTRQKIHGVNFRVIAKWMRLAGVDHIHAGTVVGKLEGdlhSV 344 Methylokorus infer...
Feature 1                                         ###                     ##                  
1SVD_A    336 LGWIDLLRESFIPEDRSRGIFFDQDWGSMPGVFAVASGGIHVWHMPALVNIFGDDSVLQFGGGTLGHPWGNAAGAAANRV 415 Halothiobacillus n...
4RUB_A    343 LGFVDLLRDDFVEQDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVANRV 422 common tobacco
1IWA_A    351 RGFYKTLLLPKLERNLQEGLFFDMEWASLRKVMPVASGGIHAGQMHQLIHYLGEDVVLQFGGGTIGHPDGIQAGATANRV 430 Galdieria partita
1BXN_A    344 QGYYNVCRDAYTQTDLTRGLFFDQDWASLRKVMPVASGGIHAGQMHQLIHLFGDDVVLQFGGGTIGHPQGIQAGATANRV 423 Cupriavidus necator
P14957    346 KGFYNTLLETQTDVNLVQGLFFAQDWAALNKCMPVASGGIHCGQMHQLINYLGDDVVLQFGGGTIGHPDGIQAGATANRV 425 Guillardia theta
P27997    344 QGYYNVCREPFNTVDLPRGIFFEQDWADLRKVMPVASGGIHAGQMHQLLSLFGDDVVLQFGGGTIGHPMGIQAGATANRV 423 Rhodobacter sphaer...
P00878    343 LGFVDLMRDAYVEKDRSRGIYFTQDWCGMGGTMPVASGGIHVWHMPALTEIFGDDACLQFGGGTLGHPWGNAPGAAANRV 422 Euglena gracilis
Q0P3J3    343 LGFVDLMRDAYVEKDRDRGIYFSQDWASLPGVMPVASGGIHVWHMPALVEIFGDDACLQFGGGTLGHPWGNAPGASANRV 422 Ostreococcus tauri
A0T0N6    346 KGFYDILRLTELEVNLPFGIFFEMDWASLRRCMPVASGGIHCGQMHQLIHYLGDDVVLQFGGGTIGHPDGIQAGATANRV 425 Thalassiosira pseu...
B3DVG5    345 QGYYKTLRTQYTEADPLLGLYFEQDWASMPGVMPVASGGIHAGQMHLLLSYLGEDTILQFGGGTIGHPDGIAAGATANRV 424 Methylokorus infer...
Feature 1                                                          
1SVD_A    416 ALEACVEARNQGRDie--kEGKEILTAAAQHSPELKIAMETWKEIKFEFDTVD 466 Halothiobacillus neapolitanus
4RUB_A    423 ALEACVKARNEGRDla--qEGNEIIREACKWSPELAAACEVWKEIVFNFAAVD 473 common tobacco
1IWA_A    431 ALEAMILARNENRDyl--tEGPEILREAAKTCGALRTALDLWKDITFNYTSTD 481 Galdieria partita
1BXN_A    424 ALEAMVLARNEGRDil--nEGPEILRDAARWCGPLRAALDTWGDISFNYTPTD 474 Cupriavidus necator
P14957    426 ALECMVVARNEGRDyv--tEGPQILRNAAKSCGPLQTALDLWKDITFNYASTD 476 Guillardia theta
P27997    424 ALEAMVLARNEGRNid--vEGPEILRAAAKWCKPLEAALDTWGNITFNYTSTD 474 Rhodobacter sphaeroides
P00878    423 ASEACVQARNEGRDls--rEGGDVIREACKWSPELAAACEVWKEIKFEFETID 473 Euglena gracilis
Q0P3J3    423 ALEACTQARNEGRDla--rEGGDVIRAACKWSPELAAACEVWKEIKFEFDTVD 473 Ostreococcus tauri
A0T0N6    426 ALEAMVLARNEGLDyfnqqVGPQILRDAAKTCGPLQTALDLWKDISFNYTSTD 478 Thalassiosira pseudonana
B3DVG5    425 AVEVMVQARNEGKDil--rEGPEILEKACRWSPALAKAIETWKDISFEFESTD 475 Methylokorus infernorum V4

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap