Conserved Protein Domain Family
RLP_NonPhot

?
cd08207: RLP_NonPhot 
Ribulose bisphosphate carboxylase like proteins from nonphototrophic bacteria
Ribulose bisphosphate carboxylase (Rubisco) plays an important role in the Calvin reductive pentose phosphate pathway. It catalyzes the primary CO2 fixation step. Rubisco is activated by carbamylation of an active site lysine, stabilized by a divalent cation, which then catalyzes the proton abstraction from the substrate ribulose 1,5 bisphosphate (RuBP) and leads to the formation of two molecules of 3-phosphoglycerate. Members of the Rubisco family can be divided into 4 subgroups, Form I-IV, which differ in their taxonomic distribution and subunit composition. Form I-III have Rubisco activity, while Form IV, also called Rubisco-like proteins (RLP), are missing critical active site residues and therefore do not catalyze CO2 fixation. They are believed to utilize a related enzymatic mechanism, but have divergent functions. The specific function of this subgroup is unknown.
Statistics
?
PSSM-Id: 173972
View PSSM: cd08207
Aligned: 16 rows
Threshold Bit Score: 591.206
Threshold Setting Gi: 227406968
Created: 7-Jan-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:annotation is based on homology to other subgroups

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
YP_001566656   9 EFTARYFVESSVaseKIAQVISGEQSSGTFLSLPgetdELKERSRARIASIKPlapglqptlpsayvgrHPHGGVFHRaE 88  Delftia acidovo...
YP_002521387   3 FVRATYYVETPLtleAAAEALASEQSTGTFIAVPletaELKARYRARIERIELietrsr----ptlpgsRPASGSYQCgF 78  Thermomicrobium...
YP_001525603   4 RFEASYLIETPLdpvKVAQVMAGEQSSGTFTRVHgetdELRARSRAEVLSVVDfgtsdtpslpnayldrRSVAGPYRRaR 83  Azorhizobium ca...
YP_001890886  14 TLQADYLIETPLdpaRVAEVMAGEQSSGTFVRVAnesdALRARSRAGVLRVEEleaaarpslpnawlerQGTPGPWRRaR 93  Burkholderia ph...
YP_001267182  10 EFTARFFVESSYpieRVSEVIAGEQSSGTFLSLPgesaELKERSRARVVAIEPlpsvsspslhsdylarHNPSETYHRgE 89  Pseudomonas put...
YP_575258     12 RITARYRIETPCdpeRAAEAMAGEQSSGTFLKLAgeteALRERHAARVESVTClkvgtt-----pslpgALPGETYTSaD 86  Chromohalobacte...
Q7WNK2         4 RFEATYLIETPHdvaSVAQELAGEQSTATSSRMPgetdALIRDFGARVEHIEAlppaea----pslpvaHTLGQRVHRaR 79  Bordetella bron...
YP_003093010   3 RITAKYYIETPLdleKSAQLLAGEQSSGTFIAVPgeteELKQRFAARVESITPmdtane----paipgvLSAGGKYQRaM 78  Pedobacter hepa...
YP_003243072   5 RVTATYLVETPLtleQAAASIAGEQSTGTFTAVPgetePLKERHGARIERITPleqvaqps-lpgalapPAAQGCYSRgE 83  Geobacillus sp....
ZP_03890203    6 RIRCTYYIEAVDv-aRAAAALAGEQSSGTFIAVPgesdRIRERHAAEVVAIRElgeca------pslpsRRRPERVTAaE 78  Geodermatophilu...
Feature 1                               #                                                 # #    
YP_001566656  89 IEIAFPVANVGanLSSMLVTIAGNLYELgevtGLRLLDLDLAPEYAAQFAGPAFGIPGTRRLAGvhgRPLIGTIIKPsIG 168 Delftia acidovo...
YP_002521387  79 VELAFPLENMGcnLPTLMATLAGNLFELselsAIRLVDLDLPDEFAQAYTGPRFGIQGTRDIAQvydRPLIGTIIKPsVG 158 Thermomicrobium...
YP_001525603  84 IRLAFPVANVGanLPTLAATAAGNLFDLgevtGLRLESLSLPDAYRRAFDMPRQGLAGTRALTGvetGPLVGSIIKPnVG 163 Azorhizobium ca...
YP_001890886  94 ITLSFPLANIDanLPTLAATVAGNLYDLgevtGMRLLSLRLPASYRKRFELPRHGVAGTRALTEvkdRPMIGTIIKPnVG 173 Burkholderia ph...
YP_001267182  90 VTIAFPTANIGtnIPALLTTIAGNLFEIgevsGLRVLDLELPERFASGFIGPQFGIEGTRALAGvhdRPIIGTIVKPsIG 169 Pseudomonas put...
YP_575258     87 VVLSWPLENIGtsLPNLLATVFGNLTELrelsGIRLTDLVMPACFIEALPGPQFSIEGTRRLCGteqGPLVGTIIKPsVG 166 Chromohalobacte...
Q7WNK2        80 LTLSWPLHNIGdsLPMLLTTLLGNQTGMrrlsGIRLERVAMPQSFIAAQPRPAFGIAGTRRLTGvqgRPLIGSIVKPnIG 159 Bordetella bron...
YP_003093010  79 IEVSWSIENFGynLPVMVSTLQGNLYELtqftGLKLMDLELPASFATAFKGPKFGIAGCRKLTGvynRPLIGTIIKPsIG 158 Pedobacter hepa...
YP_003243072  84 IVVSFPLHNFGpsIPNLMACVAGNLYELrelsGLRLVDLELPEDFKTRYPGPRFGIEGTRRITGvrgRPIIGTIIKPsVG 163 Geobacillus sp....
ZP_03890203   79 VVVEFPMVNIGtdIATLLTAVAGNLFELvelyACRLQSIGLPDEFVAAHPGPAFGVAGTRKLMGvpdGVLIGTIVKPnVG 158 Geodermatophilu...
Feature 1                             ####                                                       
YP_001566656 169 LTPAQTAELVDSLCAAGIDFIKDDELIADPPYAPFDERLRAVMPVLQRHADRLGRMPMYAINISGSVDEMLRRHDAVLAA 248 Delftia acidovo...
YP_002521387 159 LSPEQTAVVVRELVEAGIDFIKDDELMANPPHNPLPARARAVMRVIRDYADRTGKYVIYAFNISDRLEDMIRHIEILVEE 238 Thermomicrobium...
YP_001525603 164 LSAEETGELVGQLCAAGLDFIKDDEICANPSHAPLAARVPAVMRRVRDHAERTGKKVMVAFNITDETDAMRRHADLVARE 243 Azorhizobium ca...
YP_001890886 174 LSAAETAALVRDLCEAGVDFIKDDEVCANPAHAPLAERVRAVMAEVRRYRERSGRSVMVAFNITDDLDAMRRHAELVEQE 253 Burkholderia ph...
YP_001267182 170 LTPEQTASVVDELCAGGIDFIKDDELLIDPTYASFDARLGAVMPVLHKHADRLGRMPMYAINISGSIDEMMRRQDAVLEA 249 Pseudomonas put...
YP_575258    167 LTPEETATLVKQLIEGGIDFIKDDELIADPPYSPLSERVPAIMQVINEHAQRTGRKPMYAFNITGDTDEMRHRHDLVRDH 246 Chromohalobacte...
Q7WNK2       160 LAPEQTAAMARQLAEGGVDFIKDDELLANPPYSPVARRAALVLRALDEAAQRTGRRTMYAVNITDGLDEMRRHHDAVVQA 239 Bordetella bron...
YP_003093010 159 MTPEQTAALVNTLALAGIDFIKDDELLGSSANSPFDKRVDAIMEVINRHADRSGKKVMYAFNISDDIDQMQRNYEKILRS 238 Pedobacter hepa...
YP_003243072 164 LGRAELEALVYDLAVSGVDFIKDDELNANPPYLPLREKAETVMRAIGRAADKTGRKAMYACNITGDIEELQRNHEHVVKA 243 Geobacillus sp....
ZP_03890203  159 LVEEEFRGVVRELARASIDLIKDDELMTDPAYLPLETRVRVALEEIADAEQVTGHRTMYAFNITGDLAGLQRRHDLVVEA 238 Geodermatophilu...
Feature 1                                      ##                               #                
YP_001566656 249 GGSCVMVSINWVGFSAVEHLRRHSqLPIHGHRNGWGAFTRhGGLGFSFQAYQKLWRLAGVDHLHCNGIRSKFWEPDDSVI 328 Delftia acidovo...
YP_002521387 239 GARCCMVSLNWVGIAAFDYLRRNCpLIIHGHRNGWGMMTRaPGLGMDFRAYQKIWRLAGVDHLHVNGLANKFWEPDDSVV 318 Thermomicrobium...
YP_001525603 244 GGTCVMASLNWCGFSAIQTLRRSTdLALHGHRNGYGALSRaPLLGIGFQAYQVLWRLAGVDHMHVHGLKGKFAQEDAEVI 323 Azorhizobium ca...
YP_001890886 254 GGDCVMASINWCGFSAIQTLRRATpLVLHAHRNGYGMMSRdPALGMSFQAYQTLWRLSGVDHMHVHGLAGKFAQSDAEVI 333 Burkholderia ph...
YP_001267182 250 GGTCVMLCLNWVGHSAVEHIRKHAqLPIHGHRNGWGALTRyPQLGFSFEVYQKIWRLAGIDHLHVNGIQGKFYEADDSVI 329 Pseudomonas put...
YP_575258    247 GGTCVMASVNWIGLGALAALRRHSqLAIHGHRNGWGVFYRhPQLGISYRAYQALLRLAGADHLHVNGLASKFAEEDASVM 326 Chromohalobacte...
Q7WNK2       240 GGTCIMVNLNSVGLSALLALRRHSqLPIHGHRAGWAMMTRcPALGMEFQPYQMLHRLAGVDHLHVSGLGGKFWEHADSVL 319 Bordetella bron...
YP_003093010 239 GGTSAMISLNSVGLAGVKKIGEIGeLAIHGHRNGWGMLNRhPLLGIEFPAYQQLWRLAGVDQIHVNGIQNKFWESDDSVV 318 Pedobacter hepa...
YP_003243072 244 GGNCVMVSINSIGFAGLAYLNGFSeVPVHGHRNQWGMLTRhGQLGMDFRVYQKLCRLAGADHLHVNGLGSKFYESDESVA 323 Geobacillus sp....
ZP_03890203  239 GGNCVMLNVPVMGLPALAWLRGFAqVPIHGHRAGLAASMRsPALGVDFTVWQQLARLAGADHVHASGLGSKFYERDEQVA 318 Geodermatophilu...
Feature 1                                 ###                      ##                            
YP_001566656 329 ASAKACLAPwag-----lqPLMPVFSSGQWAGLAPDLYGALGaVDLMHLAGGGIIGHPDGIAAGVASMREGWEAAVAG-V 402 Delftia acidovo...
YP_002521387 319 RSIHDMLQPlfg-----gyFAMPVISSGQWGGQAPDTYRRCRtIDLLYLAGGGIFAHPHGVAAGIRAIREAWEAAVAG-I 392 Thermomicrobium...
YP_001525603 324 ESARDCVTPlsss---eddRVMPAFSSGQWAGTVPATYAATGhADLLFMAGGGIMAHPDGPSAGVASIREAWEAVMAG-E 399 Azorhizobium ca...
YP_001890886 334 ESARDCATPlaag---cddTVLPAFSSGQWAGTVQATFDAVRsTDLLFMSGGGILAHPDGPAAGVTSVRQAWAAVQAG-T 409 Burkholderia ph...
YP_001267182 330 SSAKSCLAPfag-----mrPLMPVFSSGQWAGQAPELFNRLQsVDLMHLAGGGIIGHPMGIEAGVQSMREGWEAAVQH-V 403 Pseudomonas put...
YP_575258    327 DSARACLTPllega-erddRAMPVFSSAQTVHQACPTFQQLQsTDLIYTCGGGIMAHPDGVAAGCRSIRAAWEAASIG-V 404 Chromohalobacte...
Q7WNK2       320 QAAHECLTPldtqagaaddRALPVFSGGSTIFDVAPTYQGIGtADLIFASGGGIFGHPDGLAAGCASLRQAWEAAIAG-Q 398 Bordetella bron...
YP_003093010 319 RSIEACFKPllg-----gySVLPVVSSGQWGGQAVETYRRVPsVDLLYMAGGGIMAHPDGPAGGVVALQQAWQGAVDG-L 392 Pedobacter hepa...
YP_003243072 324 RSVEACLQPmwd-----gySAMPVLSSGQWAGTAETTFERTRsVDVMHLAGGGILAHPDGPAAGVESMKQGWEAAMRG-I 397 Geobacillus sp....
ZP_03890203  319 ANIRSLQAPlgt-----ttAPLPTLSSGQNVHTPGPTFAAVGsTDLLMLAGGGIAAHPDGPAAGVRSLRQAWIAAVSGsP 393 Geodermatophilu...
Feature 1                        
YP_001566656 403 SLEHYADAHPALQRAL 418 Delftia acidovorans SPH-1
YP_002521387 393 SLAEYAQTHPDLAAAL 408 Thermomicrobium roseum DSM 5159
YP_001525603 400 GLPEAAQRAPALAKAL 415 Azorhizobium caulinodans ORS 571
YP_001890886 410 PLPVYAEHMPELRRAL 425 Burkholderia phytofirmans PsJN
YP_001267182 404 PLERYAEGRPALSAAL 419 Pseudomonas putida F1
YP_575258    405 SLEDHAKQEPDLAVAL 420 Chromohalobacter salexigens DSM 3043
Q7WNK2       399 ELRAYAQSRPELAAAL 414 Bordetella bronchiseptica
YP_003093010 393 SVAETAAKYPEFGHSV 408 Pedobacter heparinus DSM 2366
YP_003243072 398 PAEEYAKERVELRRAF 413 Geobacillus sp. Y412MC10
ZP_03890203  394 LADAAAEHAARGDSAL 409 Geodermatophilus obscurus DSM 43160

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap