1A4E


Conserved Protein Domain Family
catalase_fungal

?
cd08157: catalase_fungal 
Click on image for an interactive view with Cn3D
Fungal catalases similar to yeast catalases A and T
Catalase is a ubiquitous enzyme found in both prokaryotes and eukaryotes, which is involved in the protection of cells from the toxic effects of peroxides. It catalyzes the conversion of hydrogen peroxide to water and molecular oxygen. Catalases also utilize hydrogen peroxide to oxidize various substrates such as alcohol or phenols. This family of fungal catalases has a relatively small subunit size, and binds a protoheme IX (heme b) group buried deep inside the structure. Fungal catalases also bind NADPH as a second redox-active cofactor. They form tetramers; in eukaryotic cells, catalases are typically located in peroxisomes. Saccharomyces cerevisiae catalase T is found in the cytoplasm, though.
Statistics
?
PSSM-Id: 163713
View PSSM: cd08157
Aligned: 14 rows
Threshold Bit Score: 698.714
Threshold Setting Gi: 238843570
Created: 30-Aug-2007
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 7 residues -Click on image for an interactive view with Cn3D
Feature 1:heme binding pocket [chemical binding site]
Evidence:
  • Structure:1A4E: Saccharomyces cerevisiae catalase A binds heme, contacts calculated at 4A
    View structure with Cn3D
  • Comment:these residues are conserved in all heme-catalases
  • Citation:PMID 9931255

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                            #                                      #                 
1A4E_A     33 LQDYNLIDSLAHFNRENIPQRNPHAHGSGAFGYFEVTDDITDICGSAMFSKiGKRTKCLTRFSTVGGDKGSADTVRDPRG 112 baker's yeast
AAG45152   43 LQDFNLIDLLAHFDRERIPERVVHAKGAGAYGEFEVTDDISDITVIDMLKGvGKKTKTFVRFSTVGGEKGSPDSARDPRG 122 Emericella nidulans
EAU86801   40 LQDFHHIDLLAHFDRERIPERVVHAKGAGAHGYFETTHSLSDITSIPLFQKpGTKVRATVRFSTVGGESGSADTARDPRG 119 Coprinopsis cinere...
ABG26355  200 LQDFHLIDLLSHFDRERIPERVVHAKGSGAHGIWECTDGLEDLCLANMFQK-GATCPLTIRFSTVGGESGSPDLARDPRG 278 Filobasidiella neo...
AAG53518   60 LQDFHLVDLLSHFDRERIPERVVHAKGGGAHGYYQTTDPLDDLCLADIFQA-GKKCPISVRFSTVGGESGSHDCARDPRG 138 Passalora fulva
A6ZV70     41 LQDFHLLENIASFDRERVPERVVHAKGGGCRLEFELTDSLSDITYAAPYQNvGYKCPGLVRFSTVGGESGTPDTARDPRG 120 Saccharomyces cere...
BAE57564   34 LQDTQLIETLAHFSRERIPERVVHAKAAGAYGEFEATSDCSDITSASFLSKaGKKSPVLLRVSTVGPEAGSADTTRDVHG 113 Aspergillus oryzae
CAK46713   34 LGDTLLIETLTHFNRERIPERVVHAKGNGAWGEFRVTKDISHLTHAKFLNGvGKTTKVLFRASTTGGEKGSADTVRDVHG 113 Aspergillus niger
ABG26353   36 MQDTQLIETLAHFSRERIPERTVHASAVGAWGEFEVTHDNSDITSAAFLNGiGKKSKVLMRISTVGPEAGAAETVRDVRG 115 Filobasidiella neo...
ACJ72866   37 LSDTQTIEVLAHFARERIPERSVHAKAAGAFGEFEVLEDISHLTDADFLTGiGKKTKLLTRISTVGGEKGSSDTVRDVRG 116 Gibberella monilif...
Feature 1                     #    #       #                                                  
1A4E_A    113 FATKFYTEEGNLDWVYNNTPVFFIRDPSKFPHFIHTQKRNPQTNLRd---ADMFWDFLTTp------------------- 170 baker's yeast
AAG45152  123 FACKFYTEEGNWDWVFNNTPVFFLRDPSKFPMFIHTQKRNPQTNLKd---ATMFWDYLST-------------------- 179 Emericella nidulans
EAU86801  120 FAIKLRTEDGNWDWVFNNTPVFFLRDPAKFPHFIHTQKRDPQTHLKd---SNMFWDYLSQ-------------------- 176 Coprinopsis cinere...
ABG26355  279 FAVKFRTAEGNWDFVANNTPVFFLRDPAKFPHFIHTQKRDPTTHLSggddSTMFWDYLSQ-------------------- 338 Filobasidiella neo...
AAG53518  139 FSVKFRTEEGNWDMVANNTPVFFLRDPAKFPHFIHTQKRDPQSHLThaddSTMFWDYLSQ-------------------- 198 Passalora fulva
A6ZV70    121 VSFKFYTEWGNHDWVFNNTPVFFLRDAIKFPVFIHSQKRDPQSHLNqfqdTTIYWDYLTL-------------------- 180 Saccharomyces cere...
BAE57564  114 WAMKIYTDEGNLDWVFNNTPVFFVRDPIKFPSLNRSHKRHPTTHLPd---ANMVSNARGCfsasvqlvqaynnscintls 190 Aspergillus oryzae
CAK46713  114 FSVKFFTEEGNHDIVGNHVPVFFVRDPVRFPSLNRSHKRHPTTGLPd---MNMYWDFHSN-------------------- 170 Aspergillus niger
ABG26353  116 WSMKIFTEEGNQDFVFNSIPVFFIRDPIKFPSVNRSHKRHPAKHTAd---SSMFHNNNPE-------------------- 172 Filobasidiella neo...
ACJ72866  117 WATKFYTEEGIQDFVFNDLPVFFIRDPIKFPSMNRSHKRHPQTNVPd---NTMFWDFHLN-------------------- 173 Gibberella monilif...
Feature 1                                                                                     
1A4E_A    171 ---eNQVAIHQVMILFSDRGTPANYRSMHGYSGHTYKWSNKNGDWHYVQVHIKTDQGIKNLTIEEATKIAGsnpDYCQQD 247 baker's yeast
AAG45152  180 ----HQEAVHQVMHLFSDRGTPYSYRHMNGYSGHTYKWIKPDGTFNYVQLHLKTGQGNKTFTDAEATRLAAenpDWHTQD 255 Emericella nidulans
EAU86801  177 ----NPESIHQVMILFSDRGTPDGYFHEHGYSGHTFKWLKDDGTFVYTQVHVRADSGFKTLDADTSVKLAGenpDYGTQT 252 Coprinopsis cinere...
ABG26355  339 ----NPESIHQIMILMSDRGIPAGWRHMHGYYGHTLKVVNDNGGWVYAQFHLISDQGNKFFTSEEASTKSP---DWGQKD 411 Filobasidiella neo...
AAG53518  199 ----NPESVHQVMILMGDRGIPDGWRKMHGYAGHTLKLVNKKGDWVYAQMHMKSKQGTDFITQEDSANYSP---DYAQKD 271 Passalora fulva
A6ZV70    181 ----NPESIHQITYMFGDRGTPASWASMNAYSGHSFIMVNKEGKDTYVQFHVLSDTGFETLTGDKAAELSGshpDYNQTK 256 Saccharomyces cere...
BAE57564  191 fhvgNPEGIHELLHLFSDRGTPKSIRHMNAYSGHTYKLTKEDGSFKYVKFHIKTAQGVKNMTAEESLKIAGedpDYLIRD 270 Aspergillus oryzae
CAK46713  171 ----QPESVHTLMHVFGSRGLPQSARRMTGFGIHTFKLVGHDGKFRYCKFHFKPVLGSHNFTPEEATRMAGvnpDFHNED 246 Aspergillus niger
ABG26353  173 ----GTHAVMMLFSNRGLPYSLRQINGYSGHTYKLTKSDGSFVYVKLHFKSNQGVKGMTQAEGVRTAGEAP---DFHSTD 245 Filobasidiella neo...
ACJ72866  174 ----NPEGIHALMHLFGQRGIPASLKNINGFSVHTYTLNKADGSYVYVKWHFRPHDGIKTMDADTAQRLAGsepDYHVKD 249 Gibberella monilif...
Feature 1                                                                                     
1A4E_A    248 LFEAIQNGN----YPSWTVYIQTMTERDAKKLPFSVFDLTKVWPQGQfPLRRVGKIVLNENPLNFFAQVEQAAFAPSTTV 323 baker's yeast
AAG45152  256 LFNAIARGE----YPSWTCYVQTLSPEQAEKFRWNIFDLTKVWPQSEvPLRRFGRFTLNKNPENYFAEVEQAAFSPSHLV 331 Emericella nidulans
EAU86801  253 LFEAIENGN----HPSWTVYVQTMTPEQAESFRYNILDLTKVWPHAEfPLRPVGKLVLNENPQNYFAEIEQSAFSPSHLI 328 Coprinopsis cinere...
ABG26355  412 LYEAIERGEypswTMKVQVMTQEQAEDAWEKKRINVFDLTHVWPHGDyPLRTVGKITLNENPSNYFAEIEQATFNPAHMI 491 Filobasidiella neo...
AAG53518  272 LYQAIEKGDypgwDVEFQTMTPKEAEDLWETQKINVFDLTHVWPQKQfPRRKVGEFFLNENVKNYFAEIEQIAFNPAHMP 351 Passalora fulva
A6ZV70    257 LFTQLQNGE----KPKFNCYVQTMTPEQATKFRYSVNDLTKIWPHKEfPLRKFGTITLTENVDNYFQEIEQVAFSPTNTC 332 Saccharomyces cere...
BAE57564  271 MFEAIEKGD----YPVWNVYVQVMDPADAEKYRWNIFDMTKVWSHKDyPLRQIGKLTMNRNPKNYFTDIEQAAFSPSTMV 346 Aspergillus oryzae
CAK46713  247 LFQAILRGD----YPKWKFYIQVMEPEQAETYGRAVFDITKVWSHKDfPLIEVGEMTLNRNPENFFAEIEQAAFSPSNLV 322 Aspergillus niger
ABG26353  246 MWNAIERGD----YPTWTLYAQVMKPEEAENYRWNIFDMTKVWPHKDfPLRPLGKLTLNRNPENYFSDIEQAAFSPSTMV 321 Filobasidiella neo...
ACJ72866  250 LFKAIEKGD----FPSWGVYIQVMQPDEVEDAPIDIFDDTYTWPFEKyPLRLVGKITLNKNLNNYFQDLEQACFSPSNMV 325 Gibberella monilif...
Feature 1                   #   #                                                             
1A4E_A    324 P-YQEASADPVLQARLFSYADAHRYRL-GPNFHQIPVNCPYa------------------SKFFNPaIRDGPMNVNGNfG 383 baker's yeast
AAG45152  332 P-GVEPSADPVLQARLFSYPDTHRHRLgTSNYQSIPVNCPL-------------------RAFTPF-HRDGAMSVNGNhG 390 Emericella nidulans
EAU86801  329 P-YVEPSADPVLQSRLFSYPDTHRHRL-GVNYQQLPVNAPI-------------------VPVANF-QRDGPATFVSQ-G 385 Coprinopsis cinere...
ABG26355  492 P-GVEPSADPVLQARLFSYPDAHRHRV-GPNYQQLPVNQSAt-----------------pYATGNF-QRDGAMAFYNQ-G 550 Filobasidiella neo...
AAG53518  352 P-GIEPSADPVLQSRLFSYPDTHRHRI-GVNYQQLPVNAPRv-----------------pYRIANF-QRDGAMAYLNQ-G 410 Passalora fulva
A6ZV70    333 IpGIKPSNDSVLQARLFSYPDTQRHRL-GANYQQLPVNRPRnlgcpyskgdsqytaeqcpFKAVNF-QRDGPMSYYNF-G 409 Saccharomyces cere...
BAE57564  347 P-GIAPSADPMLQARMFAYPDAARYRL-GVNYQQLPTNAAK-------------------APVYCPyQRDGAMRFDDNyG 405 Aspergillus oryzae
CAK46713  323 P-GIAVTPDPMLQARMFAYPDAQRYRL-GVNYTQLPPNRAI-------------------CPVYAPyERDGLATMGRNyG 381 Aspergillus niger
ABG26353  322 P-GIAPSGDPMLQARMFAYPDAARYRL-GVNYQQLPCNRPV-------------------SEVYAPyQRDGAMRYMTNyG 380 Filobasidiella neo...
ACJ72866  326 P-GIGPSADPVLQARMFSYPDAHRYRV-GPNYFQLPCNKPI-------------------NKVYAPyVRDGPGTINGNyG 384 Gibberella monilif...
Feature 1                                                                                     
1A4E_A    384 SEPTYLANDKSytyiqqdrpiqqhqev---------------------------wngpaipyhwatspgDVDFVQARNLY 436 baker's yeast
AAG45152  391 ANPNYPSTFRPlqykpvkasqehek-------------------------------wagsvvteqlpvtDEDFVQANGLW 439 Emericella nidulans
EAU86801  386 ARPNYASTIQPlsykkykadinssvrdver--------------------qarhenfiggawrdleevtELDFEQPRALW 445 Coprinopsis cinere...
ABG26355  551 GRPAYLSSIEPikfqekrvnlnkvhg-----------------------------qfigeavsflseirPEDFNAPRALW 601 Filobasidiella neo...
AAG53518  411 SRPAYLSSIQPnqfrkrtvnldkthg-----------------------------hfvgdavtflseirPEDFNAPRALW 461 Passalora fulva
A6ZV70    410 PEPNYISSLPNqtlkfknedndevsdkfkgivldevtevsvrkqeqdqirnehivdakinqyyyvygisPLDFEQPRALY 489 Saccharomyces cere...
BAE57564  406 GDPNYVGSSLQptkfyqevknsgaarlsgl---------------------tehekwvgevtnfqshitDDDFVQPAALW 464 Aspergillus oryzae
CAK46713  382 GDPNYIKSTLTpgvfsqsvqevrhhew---------------------------lrsgavlglneipvdDEDFVQPRALW 434 Aspergillus niger
ABG26353  381 GDPNYVRSSLKeinfkgqlgakghstggn----------------------ekhdewvgrvaayttettDEDYVQPRMFW 438 Filobasidiella neo...
ACJ72866  385 GDPDYVGSELRpvsmskrvqvpthe------------------------------nwsghvtafatsitDKDFEQPRALW 434 Gibberella monilif...
Feature 1                                                          
1A4E_A    437 RVLgkqPGQQKNLAYNIGIHVEGa-CPQIQQRVYDMFARVDKGLSEAIKKVAE 488 baker's yeast
AAG45152  440 KVLgrqPGQQENFVGNVAGHLCNa-HPRVRQATYGMFRRVNADLGKRIEKATE 491 Emericella nidulans
EAU86801  446 SKVw-nDEQRAVFVKNVSGHLGTvkSDEIKARQLSVFARVDQSLSDRIAAAIG 497 Coprinopsis cinerea okayama7#130
ABG26355  602 QKVf-sDESKERFIQTVAGHMSTckRKEIIARQIAIFRQVSPDLGARLEKATG 653 Filobasidiella neoformans
AAG53518  462 ERVw-dDGARERFINNVSGHMSNctKEEIIKRQIAIFREVSNDLATRLEKATG 513 Passalora fulva
A6ZV70    490 EKVy-nDEQKKLFVHNVVCHACKikDPKVKKRVTQYFGLLNEDLGKVIAEGLG 541 Saccharomyces cerevisiae YJM789
BAE57564  465 EVIgrePGHQDRTIANLSGHIKNvrSPQLRNAVYELFAKVNADLGERLKKATE 517 Aspergillus oryzae
CAK46713  435 NNVf-dEAERSLWVNNVAEALEGv-VPEIQKATIAMFSRVEPQIGQRLEAKLK 485 Aspergillus niger
ABG26353  439 EVLg-kAGDQEDLITNVSCHLSKa-IPSLQKGAVEIFAKVNVDLAKSIEDRLA 489 Filobasidiella neoformans
ACJ72866  435 KIIckePNGKEQFLHNILPTLGDi-PDHMKDQVIEYFGRVDGDLKACLKEGLG 486 Gibberella moniliformis

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap