1GGE,1SY7


Conserved Protein Domain Family
catalase_clade_2

?
cd08155: catalase_clade_2 
Click on image for an interactive view with Cn3D
Clade 2 of the heme-binding enzyme catalase
Catalase is a ubiquitous enzyme found in both prokaryotes and eukaryotes, which is involved in the protection of cells from the toxic effects of peroxides. It catalyzes the conversion of hydrogen peroxide to water and molecular oxygen. Catalases also utilize hydrogen peroxide to oxidize various substrates such as alcohol or phenols. Clade 2 catalases are mostly found in bacteria and fungi; they have a large subunit size of 75 to 84 kDa, and bind a heme d group buried deep inside the structure. They appear to form tetramers. In eukaryotic cells, catalases are located in peroxisomes.
Statistics
?
PSSM-Id: 163711
View PSSM: cd08155
Aligned: 15 rows
Threshold Bit Score: 889.41
Threshold Setting Gi: 162660666
Created: 25-Apr-2007
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
heme bindingtetramer
Conserved site includes 7 residues -Click on image for an interactive view with Cn3D
Feature 1:heme binding pocket [chemical binding site]
Evidence:
  • Structure:1GGE_A: Escherichia coli catalase HPII binds heme, contacts calculated at 4A.
    View structure with Cn3D
  • Comment:these residues are conserved in all heme-catalases

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                  #                                       #                             
1GGE_A       118 DHERIPERIVHARGSAAHGYFQPYK-SLSDITKADFLSDpNKITPVFVRFSTVQGGAGSADTVRDIRGFATKFYTEEGIF 196 Escherichia coli
1SY7_A        61 DHERIPERVVHARGSGAFGKFKVYE-SASDLTMAPVLTDtSRETPVFVRFSTVLGSRGSADTVRDVRGFAVKFYTEEGNW 139 Neurospora crassa
P50979        67 DHERIPERVVHARGAGAYGYFEPYDdRLAQYTAAKFLTSpGTRTPVFVRFSTVAGSRGSADTVRDVRGFATKFYTEQGNY 146 Mycobacterium a...
Q9X576        78 DHERIPERVVHARGYGVHGFFETYE-SLAAYTRADLFQRpGERTPAFVRFSTVAGSKGSFDLARDVRGFAVKIYTKEGNW 156 Sinorhizobium m...
YP_549270     74 DHERIPERVVHARGSGAHGYFKPYK-SMVQYTSAAFLQDpAIETPVFVRFSTVAGSRGSADTVRDVRGFAVKFYTAEGNY 152 Polaromonas sp....
AAD09575      73 DHERIPERVVHARGAGAHGYFKAYDsSAEQWTKAKVLMDpSRTTPVFVRFSTVQGSRGSADTVRDVRGFAVKFYTEEGNW 152 oyster mushroom
AAQ91615      70 DHERVPERVVHARGFGAHGYLEILE-PIPQYTKADIFQR-TGRTPAFVRFSTALGSKGSPDLARDVRGFAVKIYTRKGNW 147 Antonospora loc...
XP_646153     59 DHERIPERIVHARGTGAHGYFLSYK-DHSKLTKADFLSKqDKKTPVFIRISTVQGPRGSADTVRDVHGFAVKFYTDEGNY 137 Dictyostelium d...
ZP_01885240   82 DHERIPERIVHARGSGAHGIFKLYE-SQSAFTKAAFLNDtTVETPVFVRFSTVAGSRGSTDLARDVRGFAVKFYTEEGNF 160 Pedobacter sp. ...
YP_001878660 116 DQERIPERVVHARGSGAHGYFQVYK-SLSKYTKAAFLQDpGEKTPVFVRFSTVQGFRGSPDTVRDIRGWATKFYTKEGNY 194 Akkermansia muc...
Feature 1            #    #       #                                                              
1GGE_A       197 DLVGNNTPIFFIQDAHKFPDFVHAVKPEPHWAIPqgqsaHDTFWDYVSLQPETLHNVMWAMSDRGIPRSYRTMEGFGIHT 276 Escherichia coli
1SY7_A       140 DLVGNNIPVFFIQDAIKFPDVIHAGKPEPHNEVPqaqsaHNNFWDFQFNHTEATHMFTWAMSDRAIPRSLRMMQGFGVNT 219 Neurospora crassa
P50979       147 DLVGNNFPVFFIQDGIKFPVLVHAVKPEPHNEIPqaqsaHDTLWDFVSLQPETLHAIMWLMSDRALPRSYRMMQGFGVHT 226 Mycobacterium a...
Q9X576       157 DLVGNNIPVFFIQDAIKFPDVIHSVKPEPDREFPqaqsaHDNFWDFISLTPESMHMIMWVMSDRAIPRSFRFMEGFGVHT 236 Sinorhizobium m...
YP_549270    153 DLVGNNIPVFFIQDAIKFPDLIHAVKPEPHHEMPqaasaHDTFWDFASLMPESTHMLMWTMSDRALPRSFRMMEGFGVHA 232 Polaromonas sp....
AAD09575     153 DIVGNNIPVFFIQDAIKFPDIIHAVKPEPHNEVPtgqsaHNNFWDFVGLQPESAHMIMWVMSDRAIPRSYRMMQGFGVNT 232 oyster mushroom
AAQ91615     148 DIVGNNIPVFFVQEAIKFPDIIHAGKEEPDSGFPqaqtaHDSFWDFISLNPESLHITMWAMSDRGIPRSFRFMEGFGVHT 227 Antonospora loc...
XP_646153    138 DLVGNNMPVFFIQDASSFPDFVHAVKMEPQNEMPtggsaHDTFYDFCGLKPESAHSVLWVMSDRGIPISLRHQQGFGVHS 217 Dictyostelium d...
ZP_01885240  161 DLVGNNMPVFFIQDAIKFPDLIHAVKPEPDNEIPqaasaHDTFWDFISLMPESAHMIMWAMSDRALPRSYRMMEGFGVHT 240 Pedobacter sp. ...
YP_001878660 195 DLVGNNTPVFFIQDAIKFPDFVHAVKPEPHNEMPqgqtaHDSFWDYVSLQPETLHNVMWAMSDRGIPRSFRTMEGFGIHT 274 Akkermansia muc...
Feature 1                                                                                        
1GGE_A       277 FRLINAEGKATFVRFHWKPLAGKASLVWDEAQKLTGrDPDFHRRELWEAIEAGDFPEYELGFQLIPEEDEFKFDFDLLDP 356 Escherichia coli
1SY7_A       220 YTLINAQGKRHFVKFHWTPELGVHSLVWDEALKLAGqDPDFHRKDLWEAIENGAYPKWKFGIQAIAEEDEHKFDFDILDA 299 Neurospora crassa
P50979       227 FRLVNARGRGTFVKFHWKPRLGVHSLIWDECQKIAGkDPDYNRRDLWEAIESGQYPEWELGVQLVAEDDEFSFDFDLLDA 306 Mycobacterium a...
Q9X576       237 FRFVNAKDESTFVKFHWKPKLGLQSVVWNEAVKINGaDPDFHRRDMWQAIQSGNFPEWDLHVQLFDQDFADKFDFDILDP 316 Sinorhizobium m...
YP_549270    233 FRFINARGDSHFVKFHWKPKLGVHGLAWDEAQKIAGkDPDFHRRDLWEAIESGHFPEWELGVQIVDDGQESELGFDILDA 312 Polaromonas sp....
AAD09575     233 YTLLNATGEKHFVKFHWIPELGVHSLVWDEALKIAGqDPDFHRKDLNEAIESGAYPKWRLALQVISEKDEHNFDFDILDA 312 oyster mushroom
AAQ91615     228 FRLVNAKNEYTFVKFHWKPRLGLQSVTWSEAQRLNGaDPDFHRRDLWNAIKTGNYPEWDLGLQIFSEETAKTFDFDVLDA 307 Antonospora loc...
XP_646153    218 YRFINQEGKSTFVKLHWKPLSGTCSLLWDEAQKIAGkDCDYHRRRFWEDIESGDFPQWELGAQLLDEDLQKKFDFDILDP 297 Dictyostelium d...
ZP_01885240  241 FRLINETNESFFVKFHWKPLLGVHSVAWDEAQNISGkDPDFHRRDLWDAIEAGAFPEWELGLQIIPEADEFKFDFDLLDP 320 Pedobacter sp. ...
YP_001878660 275 YKLVNEEGKSTFVRFHWKPVYGKKSLVWDEAQVLTGrDPDFHRKDLWQSIEAGDYPEYELGLQLIPEEDADQLDFDILDA 354 Akkermansia muc...
Feature 1                                                              #   #                     
1GGE_A       357 TKLIPEelvPVQRVGKMVLNRNPDNFFAENEQAAFHPGHIVPGLDFTNDPLLQGRLFSYTDTQISRLgGPNFHEIPINRP 436 Escherichia coli
1SY7_A       300 TKIWPEdlvPVRYIGEMELNRNPDEFFPQTEQIAFCTSHVVNGIGFSDDPLLQGRNFSYFDTQISRL-GVNFQELPINRP 378 Neurospora crassa
P50979       307 TKIIPEeqvPVLPVGKMVLNRNPDNFFAETEQVAFHTANVVPGIDFTNDPLLQFRNFSYLDTQLIRLgGPNFAQLPVNRP 386 Mycobacterium a...
Q9X576       317 TKIIPEevlPTKPVGRLVLDRMPENFFAETEQVAFMTQNVPPGIDFSDDPLLQGRNFSYLDTQLKRLgSPNFTHLPINAP 396 Sinorhizobium m...
YP_549270    313 TKLIPEeqvPVQIIGKLVLNRNPDNFFAETEQVAFHPGHLVPGIDFSNDPLLQGRLFSYTDTQLSRLgGANFHELPINRA 392 Polaromonas sp....
AAD09575     313 TKIWPEelvPLHFVGEMVLNKVVDEYFAEVEQVAFCTSNIVPGIGFSDDPLLQGRNFSYLDTQLSRL-GINWQQIPINRP 391 oyster mushroom
AAQ91615     308 TKLIPEelvPVRRVGRLVLDRCVDNFFAETEQVAFCTANIVPGIDFTDDPLLQGRNFSYLDTQLSRLgSPNFTQLPINAP 387 Antonospora loc...
XP_646153    298 TKLIPEeltPVIPLGRMVIDRNPDNFFAETEQVAFCVSHVVPGIDFSNDPLLQGRIFSYLDTQLSRLgGPNFNEIPINRP 377 Dictyostelium d...
ZP_01885240  321 TKLIPEelvPVQRIGKMTLNRNPDNFFAETEQVAFHVGHIVPGIDFSNDPLMQGRLFSYTDTQLIRLgGPNFHEIPINRP 400 Pedobacter sp. ...
YP_001878660 355 TKLIPEalvPVEIVGKMVLNRNPDNFFAETEQVAFCPANIVPGIDFSDDPLLQGRIFSYSDTQRHRLgGANFTEIPINRP 434 Akkermansia muc...
Feature 1                                                                                        
1GGE_A       437 TCPYHNFQRDGMHRMGIDtnpaNYEPNSIndnwpretppgpkrggfesyqERVEGNKVRErspsfgEYYSHPRLFWLsqt 516 Escherichia coli
1SY7_A       379 VCPVMNFNRDGAMRHTISrgtvNYYPNRFdacppaslk----eggyleyaQKVAGIKARArsakfkEHFSQAQLFYNsms 454 Neurospora crassa
P50979       387 VAQVRTNQHDGYAQHAIPqgrsSYFKNSIgggcpalad----edvfrhytQRVDGQTIGKraeafqNHYGQARMFFKsms 462 Mycobacterium a...
Q9X576       397 KCPFQHFQQDGHMAMRNPvgrvNYQPNSWgegpresp-----mkgfrhfpSEEQGPKLRIraesfaDHYSQARQFFIsqt 471 Sinorhizobium m...
YP_549270    393 VCPMHNFQRDGMHRQAISkgrvAYEPNTLgngaeyrvdg--aaqgfqsypEQLEPPKIRRrspsfdDHFSQATLFWNsqs 470 Polaromonas sp....
AAD09575     392 VCPVMNFQRDGQMQMKIHkgtvNYWPNRQeavqpvavs----eggyddhvRKISGIAQRMrgpkfnEHYSQAQLFYNsls 467 oyster mushroom
AAQ91615     388 KCPVRHFQQDGRMAFYNIigpaNYEPNSLgdkggpres---peegfvsypAKATGPKMRVrpssfsDHYSQATLFYNsqt 464 Antonospora loc...
XP_646153    378 VCPFANNQRDGIHRMTINkggaSYFPNSIdkgypllkepsankggfrpypENISGTKSYDrsetfeDHFSQATMFWNsms 457 Dictyostelium d...
ZP_01885240  401 IIPVHNNQRDGHMRQTINrgktSYSPNTLgdndpaqvkv--adggfssyqERIDAKKVRArsksffDHFSQARLFLNsqs 478 Pedobacter sp. ...
YP_001878660 435 ICPFHNNQRDGFHRMQIDaspaNYDPNSIgnnwpretpp--ekggfttspQTVSGVKERLrnpsfaEYYSHPRLFWMsqt 512 Akkermansia muc...
Feature 1                                                       
1GGE_A       517 PFEQRHIVDGFSFELSKvvRPYIRERVVDQLAHI-DLTLAQAVAKNL 562 Escherichia coli
1SY7_A       455 PIEKQHMINAFGFELDHceDPVVYGRMVQRLADI-DLGLAQTIAEMV 500 Neurospora crassa
P50979       463 PVEAEHIVAAFAFELGKveMPEIRSAVVAQLARV-DDQLAAQVAAKL 508 Mycobacterium avium
Q9X576       472 PPEQRHIADALTFELSKveTPVIRERMVAHLLNI-DETLGKKVGHAL 517 Sinorhizobium meliloti
YP_549270    471 VAEKDHIVAAFRFELSKvdVPEIRQRIVDNLAHV-DLKLAGRVAVTL 516 Polaromonas sp. JS666
AAD09575     468 PTEQTHLQSALAFELSHceDPAVYRNYINILNNI-DYQLAKYVAVAV 513 oyster mushroom
AAQ91615     465 DIEQRHIQSAFTFELSKvtSPAIQMRVISHLLNI-NEDLAKNIAHNL 510 Antonospora locustae
XP_646153    458 QHEKNHIIAAYTFEISKcsRPEVRTRYVNNILVNiDSVLAEKVAKNL 504 Dictyostelium discoideum AX4
ZP_01885240  479 APEKNHLIDALTFELGKvkTVAIRERMLGILSQI-EEQLAKQVAYGL 524 Pedobacter sp. BAL39
YP_001878660 513 PVEQEHIINAFSFELGKvtRPYIRERVVDLLTRI-DPDLASGVARNL 558 Akkermansia muciniphila ATCC BAA-835

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap