1M7S


Conserved Protein Domain Family
catalase_clade_1

?
cd08154: catalase_clade_1 
Click on image for an interactive view with Cn3D
Clade 1 of the heme-binding enzyme catalase
Catalase is a ubiquitous enzyme found in both prokaryotes and eukaryotes, which is involved in the protection of cells from the toxic effects of peroxides. It catalyzes the conversion of hydrogen peroxide to water and molecular oxygen. Catalases also utilize hydrogen peroxide to oxidize various substrates such as alcohol or phenols. Clade 1 catalases are found in bacteria, algae, and plants; they have a relatively small subunit size of 55 to 69 kDa, and bind a protoheme IX (heme b) group buried deep inside the structure. They appear to form tetramers. In eukaryotic cells, catalases are located in peroxisomes.
Statistics
?
PSSM-Id: 163710
View PSSM: cd08154
Aligned: 20 rows
Threshold Bit Score: 683.256
Threshold Setting Gi: 23100237
Created: 25-Apr-2007
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
heme bindingtetramer
Conserved site includes 7 residues -Click on image for an interactive view with Cn3D
Feature 1:heme binding pocket [chemical binding site]
Evidence:
  • Structure:1M7S: Pseudomonas syringae catalase catF binds heme b, contacts calculated at 4A
    View structure with Cn3D
  • Comment:these residues are conserved in all heme-catalases

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                     #                  
1M7S_A         3 TLTRDNGAVVGDNQN------------SQTAGAQGPVLLQDVQLlQKLQRFDRERIPERVVHARGTGVKGEFTASADISD 70  Pseudomonas syr...
YP_660687     24 TLTRQNGAPVGDNQN------------SQTAGPWGPVLLQDSHLiEKLAAFDRERTPERVVHARGTGVHGYYENYVDLSD 91  Pseudoalteromon...
ZP_01093988   15 TLTEDGGQPVGDNQN------------SRTAGPRGGILLDNFHLiQKLGRFDRERIPERVVHARGVGAHGQFVSYDDWSK 82  Blastopirellula...
AAB70006      16 YWTTNSGAPVWNNNN------------SMTVGTRGPILLEDYHLvEKLAQFDRERIPERVVHARGAAAKGFFEVTHDISA 83  Chlamydomonas r...
NP_845361      4 NHDKQRQSLLGKDFNengerneqailhSQTVGSRGPVLEQDSVLhEALQEFIHEKILERPVHVKGFGAFGYFQTIYPMSE 83  Bacillus anthra...
YP_632562     25 PLTTDTGSPVGTNQN------------SKTAGPRGGVLLEDFHLiEKLARFDRERIPERVVHARGTGAYGTFESYGDFSK 92  Myxococcus xant...
XP_001784759  16 FWTTNQGSPVWNNNN------------SLTVGPRGPVLLEDYHLvEKLAQFDRERIPERVVHARGASAKGFFEVTHDISH 83  Physcomitrella ...
ACB11496      16 FWTTNAGAPVWNNNS------------SLTIGSRGPILLEDYHLvEKIAQFDRERVPERVVHARGASAKGFFEVTHDISH 83  Scots pine
YP_001558017  12 YLTDSLGRPIPNDTN------------SLTVGSDGPVLLQDVHLiDKISHFDRERIPERVVHAKGTGAFGYFQPYCDWTD 79  Clostridium phy...
P25819        16 FFTTNSGAPVWNNNS------------SMTVGPRGPILLEDYHLvEKLANFDRERIPERVVHARGASAKGFFEVTHDISN 83  thale cress
Feature 1                            #                                 #    #       #            
1M7S_A        71 LSKATVFKS-GEKTPVFVRFSSVVHGNHSPETLRDPHGFATKFYTADGNWDLVGNNFPTFFIRDAIKFPDMVHAFKPDPR 149 Pseudomonas syr...
YP_660687     92 ITVAAPFQSeNKKTDVFVRFSAVIHGHQSPETLRDPRGFAVKFYTEQGNWDLVGNNFPIFFIRDAIKFPDMVHSLKPSPV 171 Pseudoalteromon...
ZP_01093988   83 FTKADLFSSqGKTTPVFLRISTVIHPKGSPEQLRDPRGFAVKFYTEQGNWDLVGNNLPIFFIRDAMKFPDMVHSLKPSPI 162 Blastopirellula...
AAB70006      84 LTAADFLRApGVQTPVIVRFSTVVHERGSPETLRDPRGFAVKFYTREGNFDMVGNNMPVFFIRDGMKFPDMVHAFKPNPK 163 Chlamydomonas r...
NP_845361     84 HTKLSFLQHsNEKVPVMVRFSLAVSTKGTPDTARNVRGFSTKFYTKEGIFDLLCNHIPVFSVRDPMRFPETIQALSPSPK 163 Bacillus anthra...
YP_632562     93 LTRASLFSAkGKKTPMFVRFSTVIHPTGSPETLRDPRGFALKFYTDEGNWDLVGNNLPIFFIRDAIKFPDMVHSLKPSPI 172 Myxococcus xant...
XP_001784759  84 LTCADFLRApGVQTPVIVRFSTVIHERGSPEAIRDPRGFAVKFYTREGNFDMVGNNIPVFFIRDGIKFPDMIHALKPNPK 163 Physcomitrella ...
ACB11496      84 LTCADFLRAaGVQTPLIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPK 163 Scots pine
YP_001558017  80 YTCAEFLKNpNCKTKVFVRFSTVIGSKGSADTVRDPRGFAVKFYTTDGIYDIVGNDLPVFFIRDGIKFPDVIHSLKPSPD 159 Clostridium phy...
P25819        84 LTCADFLRApGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPK 163 thale cress
Feature 1                                                                                        
1M7S_A       150 TNLDnDSRRFDFFSHVPEATRTLTLLYSNEGTPAGYRFMDGNGVHAYKLVNAKGEVHYVKFHWKSLQGIKNLDPKEVAQV 229 Pseudomonas syr...
YP_660687    172 TNKQsAARLFDFFSHVPESTHMLTHLFSDMGTPKSYLNMDGSSVHAFKFVNAKGQVKYFKLTWKTKQGQKNFTAQEAQEM 251 Pseudoalteromon...
ZP_01093988  163 TNQQdPNRFFDFFSHVPESTHMLTILYSDQGTPTNLRQMDGFGVHAFKWVNAAGDVTYVKFNWRSMQGLNPATAEEAAAA 242 Blastopirellula...
AAB70006     164 SHIQeAWRIMDFLSHHPESCHMLTFLLDDAGIPLNYRHMPGFGVHTMKLINKAGRETYVKFHWVPKCGEKYLLDDEAVMV 243 Chlamydomonas r...
NP_845361    164 NNLLdPNRFWSFVARAPESIHFVVHLYSDNGTAKSFRRIPGHSVNTYVWRNAEGNRKYVKYHWYPFEGVQSITNEEANKL 243 Bacillus anthra...
YP_632562    173 TNKQdPNRSFDFFSHLPESTHMLTQVYSDIGIPANYRQMNGHGVHSFKFVNAKGEYKYVKFNWSSQQGVKSLTAEDAARV 252 Myxococcus xant...
XP_001784759 164 SHIQeAWRIMDFFSHVPESCNMFTFLFDDIGIPADYRHMEGFGVHTFKLINKAGKETYVKFHWKPTCGVKNLLDDEAVLV 243 Physcomitrella ...
ACB11496     164 SHIQeDWRILDFFSHHPESLHMFTFLFDDLGIPLNYRHMDGSGVHTFTLVNKAGRQTYVKFHWRPTCGVKCLLDDEAVVV 243 Scots pine
YP_001558017 160 NNLRdPQRFWDFVSLSPEATHMVTWLYSDRGTIKDFRHVDGFGVNTYIWVNECGKRVYIKYHWKTQQGLQTIDRFEAEQL 239 Clostridium phy...
P25819       164 SHIQeNWRILDFFSHHPESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFHWKPTCGVKSLLEEDAIRV 243 thale cress
Feature 1                                                                                        
1M7S_A       230 QSkdySHLTNDLVGAIKK-GDFPKWDLYVQVLKPEELAKFDFDPLDATKIWPDv--PEKKIGQMVLNKNVDNFFQETEQV 306 Pseudomonas syr...
YP_660687    252 QGkdfQPMTTDIYTRIGEkGETASWDLYLQTMEPQQLDDFDFNPLDTTKIWPEsliPAKKIGKLTLNRVPDNFFEETEQA 331 Pseudoalteromon...
ZP_01093988  243 SAknhSGMTADLYDSINR-GQYPEWELGVQMLKPDQLDDFDFDPLDATKIWTGv--PEIKVGKMTINRVPSNFFQSTEQV 319 Blastopirellula...
AAB70006     244 GGanhSHATKDLFDAIAA-GDYPEWALMVQTMDPADEDKFDFDPLDVTKTWPEslfPMQPVGRMVLNRNVDNFFNENEQV 322 Chlamydomonas r...
NP_845361    244 AAenpDYSGKDLYDAIAN-GKPVEYGLYVQLMDPKDEAHLSYDPLDDTKAWDEkayPLIPVGKMVLNKNPENYMEQVEKV 322 Bacillus anthra...
YP_632562    253 ISedhQHATTDLYATIGA-GKFPSWELSVQVLDPKELDKFSFDPLDATKIWPEaqvPSIKLGKFTLNKMPDNFFEETEQA 331 Myxococcus xant...
XP_001784759 244 GGanhSHATQDLYDSIAA-GNFPEWKLMIQTMNPADENKFEFDPLDDTKIWPEdrfPLQPVGRMVLNRNIDNFFAENEQL 322 Physcomitrella ...
ACB11496     244 GGtnhSHATKDLYDSIAA-GNYPEWKLFIQTMDPRDEDKYDFDPLDVTKTWPEdifPLQPVGRMVLNKNIDNFFAENEQL 322 Scots pine
YP_001558017 240 AGsdpDVAVRTLYESIAN-GFYPSWELCVQMMDPDMIECLDFDPLDDTKVWPEdqfPLMPIGLMTLDCNPENFFAEVEQA 318 Clostridium phy...
P25819       244 GGtnhSHATQDLYDSIAA-GNYPEWKLFIQIIDPADEDKFDFDPLDVTKTWPEdilPLQPVGRMVLNKNIDNFFAENEQL 322 thale cress
Feature 1                             #   #                                                      
1M7S_A       307 AMAPANLVPGIEPSEDRLLQGRVFSYADTQMYRLGANGLSLPVNQPK-VAVNNGNQDGALNTGHTtsgvNYEPSRleprp 385 Pseudomonas syr...
YP_660687    332 AFAPSNLIPGIEPSEDRMLQGRLFSYADTQRYRIGVNAYRIPINAPRnAAINNHEQHGKLRTTNStrdvNYQPSRrvald 411 Pseudoalteromon...
ZP_01093988  320 AFSPGMVVPGIEPSEDRLLQGRLFSYADTQRHRIGANYLTLPINRPQ-VETVNINQDGDMNMGATtsdvNFQPSAmpdtp 398 Blastopirellula...
AAB70006     323 AFCPAIIVPGIGYSDDKLLQTRIFSYADTQRHRLGPNYLLLPVNAPR-APHHNNHHEGFMNFMHRdeeiNYFPSRfdpvr 401 Chlamydomonas r...
NP_845361    323 AFSPSNLLNGAELSDDKMLQGRANIYSDSQRRRIGPEFRKLAINQQQdWTPANQITSGDGRYVEG----KLERTS----- 393 Bacillus anthra...
YP_632562    332 AFSPGVQPPGIEPSEDRLLQGRLFSYADTQRYRIGANYQSLPINRSR-ATVSNNNQAGSMNFANTksdvNYEPSVsretq 410 Myxococcus xant...
XP_001784759 323 AFCPGVIVPGIYYSDDKMFQTRIFSYSDTQRHRLGPNYLMLPVNAPK-CAHHNNHHEGFMNFMHRdeevNYFPSRfdpvr 401 Physcomitrella ...
ACB11496     323 AFGPGLIVPGVYYTEDKLLQTRIFSYSDTQRHRLGPNYLMLPANAPK-CAHHNNHHEGFMNFMHRdeevNYFPSRfdpvr 401 Scots pine
YP_001558017 319 AFCPGNIVPGVELSADKMLQGRSFSYFDTQRHRLGPNFAQLPINRSI-SCINNNQRDGQGTYIFNpnpiNYSPNSlnc-- 395 Clostridium phy...
P25819       323 AFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPK-CAHHNNHHEGFMNFMHRdeevNYFPSRydqvr 401 thale cress
Feature 1                                                                                        
1M7S_A       386 ad-dkaryseLPLSGTTQQAkit-----------reQNFKQAGDLYRsysAKEKTDLVQKFGESLADt--LTESKNIMLS 451 Pseudomonas syr...
YP_660687    412 dd-nqykyaqTPLSGTTQQApfy-----------kqRNFAQAGEKFRsfsKVEQQHLIENLGTTLAGv-pEEEIRVIISA 478 Pseudoalteromon...
ZP_01093988  399 reeesyeysqAPLSSQVVQQria-----------ktLNFQQAGELYRsfdKDAQANLVKNFAGDLSQv-kNRQIKLRILS 466 Blastopirellula...
AAB70006     402 naervaavssAPLSGRREKMvia-----------keNNFMQAGAAGRafdAARQERFVVRVADMLADprcTQEIRRIWVG 470 Chlamydomonas r...
NP_845361    394 ----------IPKQDDFTQAg---------------EFYAKLQPIEK---EHLAENLASDLKVISDD---IRKVVLGYFH 442 Bacillus anthra...
YP_632562    411 da-pqylfsnAPLRGTTQQGgie-----------ktDNFAQAGAFYLaldAGGKDRLIKNLAADLNQv-rDAKVKARMVG 477 Myxococcus xant...
XP_001784759 402 hs-ervpisqSRLAGVREKAvip-----------keNNFQQAGERFRsfdPARQDRFIKRIVELLSDprvTQEVRSVWFS 469 Physcomitrella ...
ACB11496     402 ha-erfpipsHTHTGKREKCvie-----------keNNFKQPGERYRsfaPERQERFVKRWVAALSDprvTHEICSIWIS 469 Scots pine
YP_001558017 396 --------gfPKVAEVCQSEpecvcgyiaripiknpCDFKQAGERYEslsCEERCHLIDNIAVELYKc--NQDIIDRVLC 465 Clostridium phy...
P25819       402 ha-ekyptppAVCSGKRERCiie-----------keNNFKEPGERYRtftPERQERFIQRWIDALSDpriTHEIRSIWIS 469 thale cress
Feature 1                         
1M7S_A       452 YLYKEDPNYGTRVAEVA 468 Pseudomonas syringae
YP_660687    479 YMYNADKHYGTGVAKLA 495 Pseudoalteromonas atlantica T6c
ZP_01093988  467 FLTQSDPEYGERVTAAV 483 Blastopirellula marina DSM 3645
AAB70006     471 YWSQADPQLGARIAAKL 487 Chlamydomonas reinhardtii
NP_845361    443 NVSADLVKRIESAMQQL 459 Bacillus anthracis str. Ames
YP_632562    478 HFFMANPDYGTRLAKAV 494 Myxococcus xanthus DK 1622
XP_001784759 470 YWMQCDRTLGQRIASQF 486 Physcomitrella patens subsp. patens
ACB11496     470 YWSQCDKSLGQKIAARL 486 Scots pine
YP_001558017 466 FFFKAHQEFGEQVECAI 482 Clostridium phytofermentans ISDg
P25819       470 YWSQADKSLGQKLASRL 486 thale cress

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap