Conserved Protein Domain Family
y4iL_like

?
cd08152: y4iL_like 
Catalase-like heme-binding proteins similar to the uncharacterized y4iL
Catalase is a ubiquitous enzyme found in both prokaryotes and eukaryotes involved in the protection of cells from the toxic effects of peroxides. It catalyses the conversion of hydrogen peroxide to water and molecular oxygen. Several other related protein families share the catalase fold and bind to heme, but do not necessarily have catalase activity. This family contains uncharacterized proteins similar to Rhizobium sp. NGR234 y4iL, of mostly bacterial origin.
Statistics
?
PSSM-Id: 163708
View PSSM: cd08152
Aligned: 36 rows
Threshold Bit Score: 288.776
Threshold Setting Gi: 29828316
Created: 25-Apr-2007
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative heme
Feature 1:putative heme binding pocket [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                          #                                       #                                
P55495                   28 GPGLRGQHFKQHGCVFATFEVLADLPErLRVGLFAe-PKVYTAYIRFSNGAQ--------------IDDTKPDIHGMAIK 92  Rhiz...
YP_001866838             39 GPDLRQIHSKSHGLLGGEFIIEPNVPEdLRVGLFKk-PQTYPAWIRFSSGGSpekr-------gkfHSDSQPDVRGIAIK 110 Nost...
YP_001352552             37 GIMRRDAHPKMHGVVKAEFTVESNLAPeLRVGIFAe-PRSYQAWIRFSNQDGt------------iQADKARDIRGMAIK 103 Jant...
YP_681218                45 DEILRGVHPKSHGCLDAEFTVNRDIAPqFQVGLFAqpGKCFRARIRYSNADVlkradlekgqdatgARFLNHGSRGMAIK 124 Rose...
REF_chgcsh:AE010300_759  70 GGVKRDAHPFAHGCVKASFTVSSSIPEeFKFGIFKs-SKTYPAWIRFSNGSIt------------kKSDQEGDIRGMGIK 136 Lept...
YP_678851                42 GKVKRMFHPKMHGLVEARFSVATDIEQrYQHGIFLp-GVEYPCWIRFSNAKKk------------pAPDSKKDMRGMAIK 108 Cyto...
NP_250630                78 TRVLRDAHAKAHGCVKAEFKVRADLDPtLRRGVFAepGKSWNAWVRFSNGNAy------------pQFDSKNDARGMAIK 145 Pseu...
YP_001543602             36 DPVRRAVFLKPHGGAKATWWVRPHLPAeLRVGLLA--YDQLAAWLRFSSDTVp-------------FASDLGTTLGVGIK 100 Herp...
YP_001713744             84 GNALRDAHPKAHGCVRAEFHVLKNIPAqLAKGIFIp-DKNYEAWIRFSNASNda-----------sRADIEKDARGMAIK 151 Acin...
NP_841285                95 GGYERGGNTKTHGIVRATITIRDDLPEhCRKGIFAn-PRSYPAYIRYSGPGPnv-----------pADINDVGFMSMAMK 162 Nitr...
Feature 1                                          #    #                                                   
P55495                   93 LTGVAGrkilegeedaATHDFVLADKPVFFi-rNTSDYVRFMAefarsa--------------prgeppLAFIAWLKE-- 155 Rhiz...
YP_001866838            111 VMNVDGqkvl--ddeeKTQDFILNNYPIFLt-kDVRDYADLSRa-------------------------GSGQLSPERi- 161 Nost...
YP_001352552            104 LMGVPGdklldserheQTQDFIVISTNVFVt-rNVEEFDALIKam----------------------tgSIWAKIGFFa- 159 Jant...
YP_681218               125 VLDVGApvlle-dgcaRNQDFLMVNTPEFAf-rNVRDYLRLTKalcasadgadpllfflpgellkrgmmDMSGSLLPApa 202 Rose...
REF_chgcsh:AE010300_759 137 LLGVDGpkls--adenRTQDFLLINHPVLPv-gAPDEYLALFQaa----------------------faKKPMSYFLGg- 190 Lept...
YP_678851               109 LIGVPGeklleqhvnnVTQDFLCVTSQTLQt-rSVHDFQKSLSa-------------------------LMAGGFKLAw- 161 Cyto...
NP_250630               146 LLDVPGekllpgrghdGEQDFVMFNQPVFFi-rDIAEYRQNFAaqa---------------------dgKKALAFFPNw- 202 Pseu...
YP_001543602            101 LFGVHGrklltgeeaaLTHDLVLQNYPVFFv-dTAKDMCEFTYegl---------------------vgDGYDAYLAKh- 157 Herp...
YP_001713744            152 ILGVSGqkilenekeaTTQDFIMINHPVFFv-nDGQRYLSFMNd-------------------------LNSHNMIRKlh 205 Acin...
NP_841285               163 IMGVPGeklm--seekLTQDFIATSGGATFvtpNTRENAKLQYws----------------------lvDMTLYYFLN-- 216 Nitr...
Feature 1                                                                                                   
P55495                  156 ----------NRPEDLPVLLGFrq-------------------qVQDSPLAARYWSQVPYAYGLGna---hACRYSVVPS 203 Rhiz...
YP_001866838            162 ---------qELGYAFAILQKIgs-------------------qKVVNPLLIQYWSMAPFKFGNR------IVRLSVKSQ 207 Nost...
YP_001352552            160 ---------tHWRVIWNLVTSLk---------------------KFANPLQMRYWSTTPYLFGDT------AVKYSAIPH 203 Jant...
YP_681218               203 geppqnaglrALFEANRAFFDDfdaedmqgvisaagvvgkiqstPVRNPLFAPYFSAASFRFGKDr-----VMRFSVVPL 277 Rose...
REF_chgcsh:AE010300_759 191 ---------mPWNWKLTALQESisi----------------rrkKIPDVLEIRYWSTTPYRLGNEt----sAVKYSAIPC 241 Lept...
YP_678851               162 ----------YALTHVRVVIRSmkq-----------------isACNNLLTTSFFSTTPYRFGNNet---mAVKYAVIPQ 211 Cyto...
NP_250630               203 ---------nPASWELRHLLIAlrt----------------lapAPDSPLHAGYNGISPYKLGEH------NIKFRVVPA 251 Pseu...
YP_001543602            158 ----------PKTRKILDLMQQ----------------------NLASVFDAVYWSGLPYAFGQGryvkyrLALEALNPQ 205 Herp...
YP_001713744            206 ---------mPFALGFKGTMNAlga----------------rnsKIANPLYTRYWSMVPYQLGLGvd--rqAVKYSVRNC 258 Acin...
NP_841285               217 ----------PKDSHLLDFFMQslw-----------------taTQYNPLGQRYWSCTPYLLGEGq-----AMMYSFVPK 264 Nitr...
Feature 1                                                                                                   
P55495                  204 KDNLVSSipse----argPGYLREAMTDHLTRaarPAVFDFRVQLNDDTSa-----TTIDNPTVEWAT---PVEAVARIT 271 Rhiz...
YP_001866838            208 QPEQPPEklp------esENYLREAIVKYLTEegkEASFDFFIQFYVDDEk-----TPIEDHVKEWQEadsPFVKVATVR 276 Nost...
YP_001352552            204 VPHPDAMppn------pgPDYLRQAMVRQLGQg--EARFDFTVQLQTNAEn-----MPIEDPGKEWKEsesPFRKVATIR 270 Jant...
YP_681218               278 QSEEMAAdmasdafedfsDDYLSQALALSVATn-ePIKLSFRIQIAHEEDivndidGMIENAAKTWDEdqfSHTEVAQIT 356 Rose...
REF_chgcsh:AE010300_759 242 EIKKLEVpkn------paDDYLRQTMISHLKEk--SACFEFMIQKQGNPIs-----MPIEDPAVHWNEkdsPFIAVAKIE 308 Lept...
YP_678851               212 KNQPVTPavk------ktGNFLKEQLINDLSHt--DFYFDFMIQFQEDAKt-----MPIEDPTVKWRS---PFIKLATIK 275 Cyto...
NP_250630               252 PEKCPAYqlpkq--nqdlPNFLRAALYQQLSIdrtPACYAFQVQRQDPAKy-----MPIEDTSVEWKEsdaPFATIADII 324 Pseu...
YP_001543602            206 PPGNPQLn----------PNFLHDDLRSRLLAg--PIDLHFSIQLRTNPKl-----MPLDAATVEWSSelaPPLHVATLT 268 Herp...
YP_001713744            259 STVSATLpdh------psHNFLRDALKDTLQKq--DVCMEFLIQPRTSTK------MLVEDAMFEWKEneaPFYQVATIH 324 Acin...
NP_841285               265 TKEVERHipglp-fgtppFNYLRENMIKTLNEk--DVEFDLMIQVQTDPHl-----MPIEDSSVRWPEklsSFIPAATIH 336 Nitr...
Feature 1                                                         #   #         
P55495                  272 IPPQTFtSAAQLAFGDNLSFTPWHALLEHRPLGEINEVRRRVYLSSSGLRHE 323 Rhizobium sp. NGR234
YP_001866838            277 IFSQKFdFEERKRLDEGMLFSPWHTLLDHEPVGSVNLSRKRLYSELAKYRRE 328 Nostoc punctiforme PCC 73102
YP_001352552            271 ILQQEFdSEAQRVFGENLSFTPWHSLPAHRPLGGINRARKIVYDAISTFRHE 322 Janthinobacterium sp. Marseille
YP_681218               357 INPPCP-SAELVDTCKPLLFTPWHAVVDFEPLGGINRLRKPVYSTSAAFRRS 407 Roseobacter denitrificans OCh 114
REF_chgcsh:AE010300_759 309 IPKQEFaTPEQDRFCENLSLNPWHSLAEHRPLGGINRIRKVAYETIAKYRHE 360 Leptospira interrogans serovar L...
YP_678851               276 IPKQQFnSSEQQNYGESLSFTPWHCIKEHRPLGGVNRARKAVYIALSAFRHK 327 Cytophaga hutchinsonii ATCC 33406
NP_250630               325 VPAQDFdSREQNLFCDNLSFNPWHALPEHRPIGGINRLRKAVYEAVSGYRLG 376 Pseudomonas aeruginosa PAO1
YP_001543602            269 LPQQDIdAPGQAAYVENLAFNPWHALPEHAPVGSISEARKVVYQASAELRRQ 320 Herpetosiphon aurantiacus ATCC 2...
YP_001713744            325 IPKQSFdTPEQNQFCENLSFTPWHALPEHKPLGAINRMRKIIYENISRVRHD 376 Acinetobacter baumannii AYE
NP_841285               337 IPRQKFdSDAQFEFAKRLKMNPWHCLPEHRPLGNINRARFRMYYELSRFRQE 388 Nitrosomonas europaea ATCC 19718

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap