Conserved Protein Domain Family

cd08068: MPN_BRCC36 
Mov34/MPN/PAD-1 family: BRCC36, a subunit of BRCA1-A complex
BRCC36 (BRCA1-A complex subunit BRCC36; BRCA1/BRCA2-containing complex subunit 36; BRCA1/BRCA2-containing complex subunit 3; BRCC3; BRISC complex subunit BRCC36; BRCC36 isopeptidase complex; Lys-63-specific deubiquitinase BRCC36) and BRCC36-like domains are members of JAMM/MPN+ deubiquitinases (DUBs), possibly with Zn2+-dependent ubiquitin isopeptidase activity. BRCC36 is part of the BRCA1/BRCA2/BARD1-containing nuclear complex that displays an E3 ubiquitin ligase activity. It is targeted to DNA damage foci after irradiation; RAP80 recruits the Abraxas-BRCC36-BRCA1-BARD1 complex to DNA double strand breaks (DSBs) for DNA repair through specific recognition of Lys 63-linked polyubiquitinated proteins by its tandem ubiquitin-interacting motifs. A new protein, MERIT40 (mediator of RAP80 interactions and targeting 40 kDa), also named NBA1 (new component of the BRCA1 A complex), exists in the same BRCA1-containing complex and is essential for the integrity of the complex. There are studies suggesting that MERIT40/NBA1 ties BRCA1 complex integrity, DSB recognition, and ubiquitin chain activities to the DNA damage response. It has also been shown that BRCA1-containing complex resembles the lid complex of the 26S proteasome.
PSSM-Id: 163699
Aligned: 18 rows
Threshold Bit Score: 285.011
Threshold Setting Gi: 157871401
Created: 22-Jul-2009
Updated: 2-Oct-2020
Aligned Rows:
MPN+ (JAMM)Zinc-binding
Feature 1:MPN+ (JAMM) motif
  • Comment:Based on literature and mutation studies

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Feature 1                                #                                                       
AAH21313       9 VQAVHLEsDAFLVCLNHALSTEKEEVMGLCIGElnddirsdskftyt--------------------------------g 56  house mouse
NP_001078118   3 LTCVNMSeDVWLTCLTHALSTETEEIMGLLLGDieysk------------------------------------------ 40  thale cress
XP_001684250  20 LSEVRISdQVVQSCLRHAFTTEEEEVMGLLLGRievqpftelhidgsrdagfpaspadgavngvrsrgsgtavsiagaap 99  Leishmania majo...
XP_001762275   3 LEGVKVTqEVWLTCVTHALSTETEEIMGLLLGDiqyts------------------------------------------ 40  Physcomitrella ...
XP_002402134   3 TIRVNLSaDVYMVCLSHALSTEKEEVMGLLIGEiglysfg---------------------------------------- 42  black-legged tick
XP_001702014   3 LERVEVTnEVLLAVLAHAHSTESEEVMGLLLGDvtdpv------------------------------------------ 40  Chlamydomonas r...
XP_001605872   5 LKKVILQaDVYMVCLQHALSTENFEVMGLLIGDn---------------------------------------------- 38  jewel wasp
XP_002126342   4 VSRVYLQaDAYLSCITHALSNESEEVMGLCIGEmve-------------------------------------------- 39  Ciona intestinalis
XP_002157002   2 LKKVKIEsDVLHVCIAHALTNEREEIMGLLIGQv---------------------------------------------- 35  green hydra
XP_002426366   3 LASVHMPaDVYYACTLHALSVEEEEVMGLLIGKf---------------------------------------------- 36  human body louse
Feature 1                                                                           # #       #  
Feature 1        #                                                                               
AAH21313     135 DVRTQAMYQ-MMDQGFVGLIFSCFIEDk---NTKTGRVLYTCFQSIQaqk------------------------------ 180 house mouse
NP_001078118 110 DVRTQAMYQ-LLDSGFIGLIFSCFSED----ANKVGRIQVIAFQSSDgkpnsipksmslvlankdsvidiessssssdsi 184 thale cress
XP_001684250 176 DLCTQGRFQqYMESGWVGLIASVFNTEa---NITCGHCALHCFQAGLg-------------------------------- 220 Leishmania majo...
XP_001762275 109 DVRTQGMYQ-MLDPGFVGLIFSCFSED----SSKVGRIQAIAFQSRDgrssrpvpvwgtssnanppaatvpdfggvlega 183 Physcomitrella ...
XP_002402134 114 DVQTQAIYQ-MMDEGFVGLIFSVFSEDsttkHSVPSRVIRRAFSVAR--------------------------------- 159 black-legged tick
XP_001702014 110 DVRTQAMYQ-LLDPGFVGLIVSAFNRDa---ATEAATVQLTAFQALPdvdpq---------------------------- 157 Chlamydomonas r...
XP_001605872 106 DVGTQQMYQ-TMDPCFVGLIFSVFSEDk---STMEQEVLLTCFQSVN--------------------------------- 148 jewel wasp
XP_002126342 109 DVQTQAMYQ-MMDQSFVGLIFSCFNEN----KANMQTIEATCFQSVRespew---------------------------- 155 Ciona intestinalis
XP_002157002 105 DVQTQHAYQ-LMDKDFIGLIVSCFNQSd---QSKMGEVRVTCFQAVKfeg------------------------------ 150 green hydra
XP_002426366 104 DLRTQASYQ-MMDNRFIGVIFSVFNVD----KTKGQEIQVTCFQAARqgk------------------------------ 148 human body louse
Feature 1                                                                                        
AAH21313         --------------------------------------------------------------------------------     house mouse
NP_001078118 185 yqrsssskpeldtidtattsgskgggrvsdfgpfftnnieanitgrdethksgnlssttigidsmdmsesmqeamlrsnl 264 thale cress
XP_001684250     --------------------------------------------------------------------------------     Leishmania majo...
XP_001762275 184 dpemdldmqlatkmnmeq-----------------hgssaplenlfaisdnkpsvsgassdyvreddaftmqealhlstl 246 Physcomitrella ...
XP_002402134     --------------------------------------------------------------------------------     black-legged tick
XP_001702014     --------------------------------------------------------------------------------     Chlamydomonas r...
XP_001605872     --------------------------------------------------------------------------------     jewel wasp
XP_002126342     --------------------------------------------------------------------------------     Ciona intestinalis
XP_002157002     --------------------------------------------------------------------------------     green hydra
XP_002426366     --------------------------------------------------------------------------------     human body louse
Feature 1                                                                                        
AAH21313     181 ---sseYERIEIPIHIVPhitigkv------clesaveLPKILCQEEQDAYRRIHSlthld---------------svtk 236 house mouse
NP_001078118 265 dtsgagYVRKEVPLHVLPtssllpvn----splasfksLQRVLYEEERAAYYQSVQqnmrdgr-----------vhplaf 329 thale cress
XP_001684250 221 ------NEHVEVPMRIVPqsalfasldpigalpdttprLLQVLQQEVRDAVAATVResahdaa----------tsraarg 284 Leishmania majo...
XP_001762275 247 disdaqYIRKEVPLEILPghsrmeae----hplsslvaLQEILYAEEHAAYNQAMKqstndrg----------qlhplaa 312 Physcomitrella ...
XP_002402134 160 ------YVRAEIPLYIVPsthisna------clealvqLPQILCQEEEDMFGFTKQvprld---------------lltk 212 black-legged tick
XP_001702014 158 --aaggLIRKEVRLAVTPaatpler------sfsdvlvVQRMLLMEENEVYKKALAsalaassrssavgsgafptpelve 229 Chlamydomonas r...
XP_001605872 149 ------GKSKEIPLEIQCtpdisvn------csktmieLPKILAQEEADMAEDCSNhpdi-----------------lis 199 jewel wasp
XP_002126342 156 --daprYQRIEIPMQIERgntvsqf------nfqtltnLPKILIQEESEMYDKACGscgdg---------------vmtq 212 Ciona intestinalis
XP_002157002 151 ---ndsYERVEIEQEIVStkelsha------clqeltkLPEILLQEEISAYQESLSyadqd---------------vlta 206 green hydra
XP_002426366 149 ---egpYEKVEVPLFVEAvknfstp------csesifqLPEIISQEDLTNYHEISKscens---------------ylnk 204 human body louse
Feature 1                                             
AAH21313     237 IHNGSVFT-KNLCSQMsav--sgPLLQWLEDRLEQNQ 270 house mouse
NP_001078118 330 IHNTSTYQ-ASMCKLIeyc--lsPAINALQDRQKENK 363 thale cress
XP_001684250 285 LAEVQLFQiDRLVAEPtrkelvhCSLPLLRAEVARLE 321 Leishmania major strain Friedlin
XP_001762275 313 IHHSSTYQ-ASLTKLLeyc--lcPVSMSLWDRLQQNK 346 Physcomitrella patens subsp. patens
XP_002402134 213 MHNGSVFV-KALCNIAesv--sgPLLQSFENRLRQNQ 246 black-legged tick
XP_001702014 230 VHHAGVYQ-AHMARLVqta--lhPSLAALEALVAQQR 263 Chlamydomonas reinhardtii
XP_001605872 200 IHNNAVQT-RALGHITdvi--trPLVQTLHERLKLNR 233 jewel wasp
XP_002126342 213 IHNASVHA-QSLCNITeti--tsPLLHVLEATNKKHE 246 Ciona intestinalis
XP_002157002 207 VQNSAVYT-QAVTKIIeii--ctPIFQLMESRLAKSK 240 green hydra
XP_002426366 205 LQNDSAFV-ISQCHILsat--vnPLLLNAEVRFKHNI 238 human body louse

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap