1BH9,1BH8


Conserved Protein Domain Family
TAF11

?
cd08048: TAF11 
Click on image for an interactive view with Cn3D
TATA Binding Protein (TBP) Associated Factor 11 (TAF11) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex
The TATA Binding Protein (TBP) Associated Factor 11 (TAF11) is one of several TAFs that bind TBP and are involved in forming the Transcription Factor IID (TFIID) complex. TFIID is one of seven General Transcription Factors (GTF) (TFIIA, TFIIB, TFIID, TFIIE, TFIIF, and TFIID) that are involved in accurate initiation of transcription by RNA polymerase II in eukaryotes. TFIID plays an important role in the recognition of promoter DNA and assembly of the pre-initiation complex. TFIID complex is composed of the TBP and at least 13 TAFs. TAFs from various species were originally named by their predicted molecular weight or their electrophoretic mobility in polyacrylamide gels. A new, unified nomenclature for the pol II TAFs has been suggested to show the relationship between TAF orthologs and paralogs. Several hypotheses are proposed for TAFs functions such as serving as activator-binding sites, core-promoter recognition or a role in essential catalytic activity. TAF11 interacts with the ligand binding domains of the nuclear receptors for vitamin D3 and thyroid hormone. TAF11 also directly interacts with TFIIA, acting as a bridging factor that stabilizes the TFIIA-TBP-DNA complex. Each TAF, with the help of a specific activator, is required only for the expression of subset of genes and is not universally involved for transcription as are GTFs. In yeast and human cells, TAFs have been found as components of other complexes besides TFIID. Several TAFs interact via histone-fold (HFD) motifs; HFD is the interaction motif involved in heterodimerization of the core histones and their assembly into nucleosome octamers. The minimal HFD contains three alpha-helices linked by two loops and is found in core histones, TAFS and many other transcription factors. TFIID has a histone octamer-like substructure. The TAF11 domain is structurally analogous to histone H3 and interacts with TAF13, making a novel histone-like heterodimer. The dimer may be structurally and functionally similar to the spt3 protein within the SAGA histone acetyltransferase complex.
Statistics
?
PSSM-Id: 173967
View PSSM: cd08048
Aligned: 49 rows
Threshold Bit Score: 75.6807
Threshold Setting Gi: 75272888
Created: 2-Oct-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
heterodimer
Conserved site includes 31 residues -Click on image for an interactive view with Cn3D
Feature 1:heterodimer interface [polypeptide binding site]
Evidence:
  • Structure:1BH9: human TAF11 makes a histone-like heterodimer with TAF13; contacts at 4.0A
    View structure with Cn3D
  • Comment:Human TAF11 forms histone fold and interacts with TAF13
  • Citation:PMID 9695952

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1           #  ##  ##  # ##  ##  ##  ##           #  ### ###  #   #                      
1BH9_B         1 FSEEQLNRYEMYRRSaFPKAAIKRLIQSITgtSVSQNVVIAMSGISKVFVGEVVEEALDVCEKWGE-------------- 66  human
Q9C2R5       207 FSPDQFDRFENWRAAnLSKAGVRRLINATIsqSVTENVVIGMRAVAKVFIGDIIEGARRVQAEWIEktgekqtdlpsppa 286 Neurospora crassa
EEU44908     176 FDSQQYNRYELWRAAkLADSVVKRVVNATVsqSVPQNVSTAVKAVAKLFAGEIIEAARNVQAEWITtgekqselptppps 255 Nectria haemato...
XP_001802096 156 MTPLQLERYATYRRIrLKRETVRKLVNQTLsqSVPQPVIIAVTSYAKSFIGDLIDRALTVRDEWTLasthlpngalppsv 235 Phaeosphaeria n...
XP_002555219 149 LDEEQMNRFEVFRRTsLAKNNIKKISSIITnqTVAANINLLLAGVGKIFIGEIVEKAQEVKKRKLAalmasrfrdkqita 228 Lachancea therm...
EDP51213     178 FNPIQSERYDLFKRAkLRKETLRRIVNHALsqSVPASVVTTINGFTKVFAGEIIEKARTVQAEWAIahdqaaraafdaee 257 Aspergillus fum...
NP_984275    128 LDDEQMNRYEVFKRTsLAKNQVKKISGIVAnqTVAANVNLLLGGIGKIFVGKIVEKALDVKHKWLLglmvnkfherkvig 207 Ashbya gossypii...
XP_002491965 136 FDQDQMTRYEFFRRAnVNKSVAKRIVQSVLgqSINNNVALLVSTVSKMFVGEMVEKAKEVQSRRQKaqileqisqrkaai 215 Pichia pastoris...
XP_364614    214 MDADQFDRYSNWRAAkLPDPVVRRIVNATVsqSVPLQVVTAVRTVTKFYLCDIIMIARQVQAEWIAsgeepqaapvtene 293 Magnaporthe gri...
Q04226       131 LDKDQTNRFEVFHRTsLNKTQVKKLASTVAnqTISENIRVFLQAVGKIYAGEIIELAMIVKNKWLTsqmciefdkrtkig 210 baker's yeast
Feature 1                                                                                        
1BH9_B           --------------------------------------------------------------------------------     human
Q9C2R5       287 tphaaasnnnnnnlaggegqqqsqtlgns-------------------------aqtngengeggdaaaaaadkgdetmp 341 Neurospora crassa
EEU44908         --------------------------------------------------------------------------------     Nectria haemato...
XP_001802096 236 lmqslqrpsahikdernrptnq--------------------------------------ditsagmylnqvdrtdtlwk 277 Phaeosphaeria n...
XP_002555219 229 yrlkkilkkltlmvegpdasyddsvdenesdlcedde---------denlvnevntynrlirskinseasrlgiirhynk 299 Lachancea therm...
EDP51213     258 aeaearaaeaaaregqgqsqpqtsvkkehsdsnrstp--------ippsssspmpqqqasqpstpsvsgppqqqqqeqqp 329 Aspergillus fum...
NP_984275    208 yklkkhlkkltllveegdgiedeimeqesdicddds-----------keeatfvhtsnrllkttknseeirkgiisqynq 276 Ashbya gossypii...
XP_002491965 216 knirkr----------------------------------------------------------------------dlde 225 Pichia pastoris...
XP_364614    294 dgsfevgeeipwpgqvmsaaeeeaaeeaaa----------------------asqadssatlnnsfpeggaasasfasri 351 Magnaporthe gri...
Q04226       211 yklkkylkkltfsiienqqykqdyqsdsvpedepdfyfddeevdkrettlgnsllqskslqqsdhnsqdlklqlieqynk 290 baker's yeast
Feature 1                         #####  ##  #    
1BH9_B        67 ----------------MPPLQPKHMREAVRRLK 83  human
Q9C2R5       342 dasqqekekekerddrRGPLRPEHLREALRRYK 374 Neurospora crassa
EEU44908     256 --nndaaaeeeevdlkRGPLRPDHLREAWRRYR 286 Nectria haematococca mpVI 77-13-4
XP_001802096 278 einedeglqerlkqsnKGPLTPAHLREALRRYK 310 Phaeosphaeria nodorum SN15
XP_002555219 300 lvksfnaldvsvekftNCPLLPEHIREAWRLYR 332 Lachancea thermotolerans CBS 6340
EDP51213     330 pparpkrefkpppnphRGQLLPSHLREALRRYK 362 Aspergillus fumigatus A1163
NP_984275    277 lvrrfnkldvsvekyvNSPLLPEHIHEAWRLYR 309 Ashbya gossypii ATCC 10895
XP_002491965 226 svvdqimnskriripkDEPLSPEDIREAWRLYQ 258 Pichia pastoris GS115
XP_364614    352 derdrqkrevilreppRGPLRPDHLREALVLRA 384 Magnaporthe grisea 70-15
Q04226       291 lvlqfnkldvsiekynNSPLLPEHIREAWRLYR 323 baker's yeast

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap