Conserved Protein Domain Family
Gallate_Doxase_N

?
cd07950: Gallate_Doxase_N 
The N-terminal domain of the Class III extradiol dioxygenase, Gallate Dioxygenase, which catalyzes the oxidization and subsequent ring-opening of gallate.
Gallate Dioxygenase catalyzes the oxidization and subsequent ring-opening of gallate, an intermediate in the degradation of the aromatic compound, syringate. The reaction product of gallate dioxygenase is 4-oxalomesaconate. The amino acid sequence of the N-terminal and C-terminal regions of gallate dioxygenase exhibits homology with the sequence of PCA 4,5-dioxygenase B (catalytic) and A subunits, respectively. The enzyme is estimated to be a homodimer according to the Escherichia coli enzyme. LigAB-like enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. In this subfamily, the subunits A and B are fused to make a single polypeptide chain. The dimer interface for this subfamily may resemble the tetramer interface of classical LigAB enzymes. Gallate Dioxygenase belongs to the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon.
Statistics
?
PSSM-Id: 153387
View PSSM: cd07950
Aligned: 8 rows
Threshold Bit Score: 508.124
Threshold Setting Gi: 92112457
Created: 20-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:Fe(II) binding site [ion binding site]
Evidence:
  • Comment:based on similarity to other members of the same protein family

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                   #                                               #                    
YP_001478327   1 MAKIIGGLAVSHTPTIGFAVDHNKQNETAWAPIFDGFAPMQQWLEe-KKPDVLLYVFNDHVTSFFFdHYSAFVLGIDDSY 79  Serratia protea...
BAD80871       1 MAKIIGGFAVSHTPTIAFAHDANKYDDPVWAPIFQGFEPVKQWLAe-QKPDVTFYVYNDHMTSFFE-HYSHFALGVGEEY 78  Sphingomonas pa...
ZP_03263969    1 MARIIGGIGTSHVPTIGLAYDKGKQNEPAWAPLFKGYEPVAQWLAe-QKPDVMVMFYNDHANSFFFdCYPTFALGVSPNH 79  Burkholderia sp...
Q8PCD0         1 MASIIGGIGTSHVPTIGVAYDKGKQQDPLWKPLFDGYTPVANWLAe-QQPDVLVFFYNDHCTTFFFdLYPTFALGVGERF 79  Xanthomonas cam...
YP_585850      1 MATIIGAIASSHTPTIGFALDAGKQQDPAWAPIFAAYAPVSEWLAr-KKPDVLLVVYNDHVTSFFFdHYSAFALGIGDTY 79  Ralstonia metal...
YP_001238264   1 MARIIGGIGASHSPTIGFARDTNKQNDPAWKPIFDGFAVVRDWVRk-TDIDVLFMIYNDHVTSFFFdHYSAFALGIDDSY 79  Bradyrhizobium ...
YP_572385      1 MGKIVAGIGSSHVPSIGRAYDQKKQADPAWQPLFDGYEPVKRWLAeeVKADVVILVYNDHGTEFFLdRYPTFALGVADSY 80  Chromohalobacte...
ZP_04772305    1 MAQIIGAIASSHTPTIGFARDTNKQADPAWKPIFDAYTPVQDWLVk-RKPDVLFFIYNDHITSFFFdHYSAFCLGVDDQY 79  Asticcacaulis e...
Feature 1                                                                                        
YP_001478327  80 AVADEGGGPRDLPPIRGHAALSQHIGASLMADEFDMSFFQDKPLDHGLFSPLSALLPWqn-gWPMQVVPLQVGVLQFPIP 158 Serratia protea...
BAD80871      79 SPADEGGGQRDLPPIKGDPELAKHIAECLVADEFDLAYWQGMGLDHGAFSPLSVLLPHeh-gWPCRIVPLQCGVLQHPIP 157 Sphingomonas pa...
ZP_03263969   80 EFADEGAGKRPLPDIAGHPDLAIHIVEQLVAEEFDLTVFQDRPLDHGVNSPLSLMLPHqg-gWPLSLVPLEVNVLQYPLP 158 Burkholderia sp...
Q8PCD0        80 PIADEGAGLRDLPPIRGDVKLQAHIAECLVNDEFDLTVFQDKPIDHGCAAPLPLLWPHvp-dWPGTVVPIAINVLQYPLP 158 Xanthomonas cam...
YP_585850     80 HAADEGGGPRNLPPARGHVELARHVGASLVADEFDMSFFQDKPLDHGCFSPMSVMLPHeg-eWPVKILPLQVGVLQFPAP 158 Ralstonia metal...
YP_001238264  80 VAADEGGGPRNVPPARGHLGLSQHIAMAMVADEFDLSFFQGKPVDHGLLSPLSMMGDAsd-pWPGTVVPLQVGVLQLPIP 158 Bradyrhizobium ...
YP_572385     81 EVADEGYGKRPLPDFPGDAAFSEHLANHLVADEFDLTLCQEMALDHGFLTAMPLLWDHddtaWPVKVVPLLVNVIQHPLP 160 Chromohalobacte...
ZP_04772305   80 RVADEGGGSRDLPAVKGHAGLARHIGQSLMADEFDMAFFRDKPLDHGCFSPLSVLMPDaqadWPVQIVPLQVGVLQFPLP 159 Asticcacaulis e...
Feature 1                                                                                        
YP_001478327 159 SARRCYKLGQALRRAIESFpEDLRVAVVATGGVSHQVHGERCGFNNPQWDEQFVDLLVNDPERLTEITLAEYATLGGLEG 238 Serratia protea...
BAD80871     158 KARRFWNFGRSLRRAIQSYpRDIKVAIAGTGGLSHQVHGERAGFNNTEWDMEFMERLANDPESLLGATVTDLAKKGGWEG 237 Sphingomonas pa...
ZP_03263969  159 TANRCYRLGQALRRAIESFeQDLKVVVVGTGGLSHQVHGERSGFNNTEWDMEFLDLIVNDPERLAAMKHVDYVRLGGAES 238 Burkholderia sp...
Q8PCD0       159 TARRCYRLGQALRRAIESYpEDLKVVVVGTGGLSHQIHGERTGFNNTEWDMEFLDRFQHAPETLTDLTHTDYVRLGGAES 238 Xanthomonas cam...
YP_585850    159 SARRCYKLGQAIRRAVESYpEDLKVAIVATGGLSHQVHGERAGFNNTAWDHQFLDLFESDPESLLDITHAEYAKRGGFES 238 Ralstonia metal...
YP_001238264 159 SAKRMWKLGRTLRKAIESYpEDLKVAIFATGGLSHQVHGERAGFLNEDWDNEFLDLLEKEPEGLTAMRIADYAVKGGMEG 238 Bradyrhizobium ...
YP_572385    161 TGQRCFKLGEAIRRAVEAYpEDTRVVVVGTGGLSHQLNGERFGHINEEWDKQWLQRIQDEPRELAALSHKEVMTAAGAEG 240 Chromohalobacte...
ZP_04772305  160 TARRCFKLGQALRKAIESYpEDLDVAIVATGGLSHQVHGERAGFNNPEWDARFMELIEEDPEQLASMTHAQYATLGGLEG 239 Asticcacaulis e...
Feature 1         #                                     
YP_001478327 239 AEVIMWLIMRGALSANVEKLHQAYYLPSMTGIATLILEN 277 Serratia proteamaculans 568
BAD80871     238 AEVVMWLLMRGALSPEVKTLHQSYFLPSMTAIATMLFED 276 Sphingomonas paucimobilis
ZP_03263969  239 VETIMWLAMRGALGKKVRELHRNYYLATSTAMAVTIYEE 277 Burkholderia sp. H160
Q8PCD0       239 VEQIMWLAMRGAMGGPIRKLHQNYYLMTTTAMTVVLYEP 277 Xanthomonas campestris pv. campestris
YP_585850    239 AEVVMWMVMRGAMSSRVRCLHRDYYLPSMTGIAVAVYEN 277 Ralstonia metallidurans CH34
YP_001238264 239 AEVIMWLIMRGALSDKVRLVHKQTYAPSVTNIATLVFED 277 Bradyrhizobium sp. BTAi1
YP_572385    241 GEVIMWFVMRGAMTERVEEVHRFYYAPMTTGIGLLALNN 279 Chromohalobacter salexigens DSM 3043
ZP_04772305  240 AEVIMWLIMRGALPDQIRCLHKSYYLPSMTGIATAVFEP 278 Asticcacaulis excentricus CB 48

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap