
Conserved Protein Domain Family

cd07932: arginine_kinase_like 
Click on image for an interactive view with Cn3D
Phosphagen (guanidino) kinases such as arginine kinase and similar enzymes.
Eukaryotic arginine kinase-like phosphagen (guanidino) kinases are enzymes that transphosphorylate a high energy phosphoguanidino compound, like phosphoarginine in the case of arginine kinase (AK), which is used as an energy-storage and -transport metabolite, to ADP, thereby creating ATP. The substrate binding site is located in the cleft between the N and C-terminal domains, but most of the catalytic residues are found in the larger C-terminal domain. Besides AK, one of the most studied members of this family, this model also represents a phosphagen kinase with different substrate specificity, hypotaurocyamine kinase (HTK).
PSSM-Id: 153079
Aligned: 16 rows
Threshold Bit Score: 554.617
Threshold Setting Gi: 170588187
Created: 28-Aug-2009
Updated: 2-Oct-2020
Aligned Rows:
Conserved site includes 15 residues -Click on image for an interactive view with Cn3D
Feature 1:ADP binding site [chemical binding site]
  • Structure:1M15: a transition state analogue of Limulus polyphemus arginine kinase binds ADP-Mg++, contacts at 4A
    View structure with Cn3D
  • Citation:PMID 9041648

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
Feature 1                                               # # #                                    
Feature 1                               #                                    #       #           
Feature 1                                               # ###                        # # ##      
Feature 1           #                                
XP_001898855 360 KYYLISNKKTLGVTQYEAVKQMYDGIKELIRMEEHS 395 agent of lymphatic filariasis

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap