1M15,2J1Q


Conserved Protein Domain Family
arginine_kinase_like

?
cd07932: arginine_kinase_like 
Click on image for an interactive view with Cn3D
Phosphagen (guanidino) kinases such as arginine kinase and similar enzymes.
Eukaryotic arginine kinase-like phosphagen (guanidino) kinases are enzymes that transphosphorylate a high energy phosphoguanidino compound, like phosphoarginine in the case of arginine kinase (AK), which is used as an energy-storage and -transport metabolite, to ADP, thereby creating ATP. The substrate binding site is located in the cleft between the N and C-terminal domains, but most of the catalytic residues are found in the larger C-terminal domain. Besides AK, one of the most studied members of this family, this model also represents a phosphagen kinase with different substrate specificity, hypotaurocyamine kinase (HTK).
Statistics
?
PSSM-Id: 153079
View PSSM: cd07932
Aligned: 16 rows
Threshold Bit Score: 554.617
Threshold Setting Gi: 170588187
Created: 28-Aug-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 15 residues -Click on image for an interactive view with Cn3D
Feature 1:ADP binding site [chemical binding site]
Evidence:
  • Structure:1M15: a transition state analogue of Limulus polyphemus arginine kinase binds ADP-Mg++, contacts at 4A
    View structure with Cn3D
  • Citation:PMID 9041648

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
1M15_A         9 KLEAGFKKLqeASDCKSLLKKHLTKDVFDSIKNKKTGMGATLLDVIQSGVENldSGVGIYAPDAESYRTFG--PLFDPII 86  Limulus polyphemus
2J1Q_A         9 KLEAAFAKLqnASDCHSLLKKYLTKEVFDQLKGKQTKMGATLMDVIQSGVENldSGIGVYAPDAESYTLFA--ALLDPII 86  Trypanosoma cruzi
BAB91357      14 KPVDELWQSlqKGNSKSLLKKHLTEERYKKLKDKKTSLGGTLAQCISSGALHagSKVGIYACDPAVYTDPDycDLFKLVI 93  Corbicula japonica
Q10454        47 KIEEGYAKLqaAPECHSLLKKYLTKEVVDQLKDKKTKLGANLLDVIQSGVANldSGVGVYAPDAEAYTLFK--PLFDPLI 124 nematode
NP_001141078   9 KLEEGFKKLeaATDCKSLLKKYLTKDIFDSLKAKKTGLGATLLDVIQSGVENldSGVGIYAPDAEAYSLFA--PLFDPII 86  maize
BAE16970       5 DYDGFMKKLhdAKDCHSLAKKFVTPEAAKKFKDKKTKLGGTLAHCIKPGAQFhhLHIGIYACDPEAYVTFA--EVFDKVV 82  Siphonosoma cum...
ACU68932       9 KLEAGFSKLq-ASDSKSLLKKYLTKEVFDALKNKKTTFGSTLLDCIQSGVENldSGVGIYAPDAEAYTVFA--DLFDPII 85  beet armyworm
BAB91357     372 KPLDELWNTisKSDSQSLMKKFLTQDVYNKLKDKKTSLGGTLAHCINSGCIHlgSKVGIYACDPEAYTVFE--DIFNNVI 449 Corbicula japonica
XP_001898855  47 RVNAAYAELqkDRNCNSLLKKYLTPTILKKLENKKTKLGVSLYDIIRSGLHNhgLAIGVYAADPESYQKFA--VLFDKIL 124 agent of lympha...
XP_393299     27 ALDEAYENFt-KVESGSLLKKYLDRHVFNMLKTRLTNTQSSLMDVIQSGLKNldSNVGIYAPDQHSYSVFA--PLFNPVI 103 honey bee
Feature 1                                               # # #                                    
1M15_A        87 DDYHg-gFKLTDKHppKQWGDIn---TLVGLDPaGQFIISTRVRCGRSLQGYPFNPCLTAEQYKEMEEKVSSTLSSMED- 161 Limulus polyphemus
2J1Q_A        87 EDYHk-gFKPSDKQppKDSGDLn---TFIDVDPdKKYVISTRVRCGRSLEGYPFNPCLKKQQYEEMESRVKGQLESMSG- 161 Trypanosoma cruzi
BAB91357      94 QDYHtgnASGNVKHpePSFGTDaqidSLGDLDPtGYFVKSTRVRVARSHKGMPFPPSARKEDFEKMEKLACEGLYTMTG- 172 Corbicula japonica
Q10454       125 QDYHn-gFAPDAKQpnTDLGEGkt-sALVDLDPeGKFINSTRIRCGRSLQGYPFNPCLSEANYLEMESKVKAIFDNITDp 202 nematode
NP_001141078  87 EDYHk-gFKQTDKHpaKDFGDVs---KFINVDPeGTFVISTRVRCGRSMEGYPFNPCLTEAQYKEMEEKVSSTLSGLEG- 161 maize
BAE16970      83 ADYHgvpSNQPISHpaPNFGDLnn-lPFNDLDPeGKYVISTRVRVGRSVDGIPFPPLINLQQVKDCEQRLVSALKTFQG- 160 Siphonosoma cum...
ACU68932      86 EDYHn-gFKKTDKHpaKNWGDVe---TLGNLDPaGEFVVSTRVRCGRSMEGYPFNPCLTEAQYKEMEEKVASTLSGLEG- 160 beet armyworm
BAB91357     450 KAYH---KVDKIDHpkPTFGTEaemkALENIDPeGKMVVSTRIRVARSHAKYPFPPACNSEDFENMQDDTVAALNTLTG- 525 Corbicula japonica
XP_001898855 125 EDYHa--FKPGDKQpaVDFGEErl-gELSLLDPaGKYVKSVRIRCARSIAGYPFNPLLSADDYIILEQKVKNALLQIEEp 201 agent of lympha...
XP_393299    104 EEYHr-gFTPEDVHppLDWGDPe---KLGNLDPdGEFIISTRIRCARSVNGYPLNPTMTKSHYQELEAKVQQILSTLED- 178 honey bee
Feature 1                               #                                    #       #           
1M15_A       162 ELKGTYYPLTGMSKATQQQLIDDHFLFKEGDRFLQTANACRY-WPTGRGIFHNDAKTFLVWVNEEDHLRIISMQKGGDLK 240 Limulus polyphemus
2J1Q_A       162 ELRGKYYPLTGMTKETQKQLIDDHFLFKEGDRFLQAAHACKF-WPTGRGIYHNDAKTFLVWVNEEDHLRIISMQKGGNLK 240 Trypanosoma cruzi
BAB91357     173 ELAGTYYPLRGMDKATQNKMIEDHFLFRADDAVLGDAGGYSC-WDTGRGIFHNKDKTFLTWLNEEDHFRFISMQMGGNLG 251 Corbicula japonica
Q10454       203 ELAGKYFPLDGMTKEIQDQLIKDHFLFKEGDRFLQAANACRY-WPKGRGIFHNNQKTFLIWCNEEDHLRIISMQEGGNVG 281 nematode
NP_001141078 162 ELKGSYFPLTGMTKEVQQKLIDDHFLFKEGDRFLQAANACRY-WPAGRGIYHNDNKTFLVWCNEEDHLRIISMQMGGDLG 240 maize
BAE16970     161 DLSGQYYSLEGMDEATKNKLIDDHFLFGDPPNKILVGAGVEPdWPKGRGIFHNNSKTFLAWINEEDHIRIISMQMGGNLA 240 Siphonosoma cum...
ACU68932     161 ELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRF-WPSGRGIYHNENKTFLVWCSEEDHLRLISMQMGDDLK 239 beet armyworm
BAB91357     526 ELAGTYFPLAKMDEATQKQLVADHFLFRDDDDVLRDAGGYKY-WDAGRGIFHNKDKTFLTWVNEEDHLRLISMQKGGDLG 604 Corbicula japonica
XP_001898855 202 ELRGIYYSLDGIPKKTKDHLYSKQLLFNNNNSLLKHANAYNA-WPEGRGIFYNSDKSFLVWVNEEDHVSMISVEEGSDIG 280 agent of lympha...
XP_393299    179 ELKGNYYSLIKMDKITQQQLIDDHFLFKEGDRFLEAANSNRF-WPVGRGIFYNDAKTFLVWCNEEDHLRLISMQKGGDLA 257 honey bee
Feature 1                                               # ###                        # # ##      
1M15_A       241 TVYKRLVTAVDNIESKLPFSHDDRFGFLTFCPTNLGTTMRASVHIQLPKLAKDrKVLEDIASKFNLQVRGTRGEHTESEG 320 Limulus polyphemus
2J1Q_A       241 EVFGRLVTAVGVIEEKVKFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLGADrKKLEEVAAKYNLQVRGTAGEHSDSPD 320 Trypanosoma cruzi
BAB91357     252 QVYKRLVTAIKHIETKMQFAKADGLGYLTFCPTNLGTTMRASVHVRVPMLSKDpKVLNEICAKYNLQPRGVHGEHSESKG 331 Corbicula japonica
Q10454       282 QVLERLIKGVKTIEKQAPFSRDDRLGWLTFCPSNLGTTVRASVHIRLPKISAK-PDFKSICDGLKLQIRGIHGEHSESEG 360 nematode
NP_001141078 241 QVYRRLVSAVNDIEKRVPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANrEKLEEVAAKFSLQVRGTRGEHTEAEG 320 maize
BAE16970     241 EVYKRLVTAIQHIEKTVKFAHDPRLGYLTFCPSNLGTTCRASVHVKIPKVSAL-KNFKGIVECLGLQLRGTAGEHTESVG 319 Siphonosoma cum...
ACU68932     240 QVYKRLVNAVNDIEKRIPFSHDDRLGFLTFCPTNLGTTVRASVHIKLPKLAADkARLEEIASKYHLQVRGTRGEHTEAEG 319 beet armyworm
BAB91357     605 TVYRRLVKAINELEKKLTFAKRDGYGYLTFCPSNLGTTLRASVHMAIPNVSKQ-PNFKEFCEKYSIQPRGIHGEHSESEG 683 Corbicula japonica
XP_001898855 281 KAFARLIRGLKALEQKLTFAEDNRLGWLTSNPSNLGSAVSASVQICLPKLSKK-SDLMEICEKLNLRVVSVDITSSEVPN 359 agent of lympha...
XP_393299    258 AVYSRLVRGATEVGKKIPFSRHRRLGYLTFCPTNLGTTIRASVHARFPKLNTNpERFHEIANMYNLQIRGTRGEHTEGEE 337 honey bee
Feature 1           #                                
1M15_A       321 GVYDISNKRRLGLTEYQAVREMQDGILEMIKMEKAA 356 Limulus polyphemus
2J1Q_A       321 GVYDISNKRRLGLSEYEAVKEMQDGILELIKAEESA 356 Trypanosoma cruzi
BAB91357     332 GVYDISNKRRLGLTEWEAVTEMKNGVLEIIKEEAKL 367 Corbicula japonica
Q10454       361 GVYDISNKARLGLTEFEAVKQMYDGIAHLIALEKAA 396 nematode
NP_001141078 321 GIYDISNKRRMGLTEFQAVKEMQDGILELIKIEKEM 356 maize
BAE16970     320 GVWDVSNKRRLGYSEIDALTEMANGVKLLILLEKSL 355 Siphonosoma cumanense
ACU68932     320 GVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL 355 beet armyworm
BAB91357     684 GVYDLSNKRRLGLTEYQAVREMLDGVLAIKKWEEEL 719 Corbicula japonica
XP_001898855 360 KYYLISNKKTLGVTQYEAVKQMYDGIKELIRMEEHS 395 agent of lymphatic filariasis
XP_393299    338 GVFDISNKRRLGLTENDVVSEMRIGILELIKEEKRL 373 honey bee

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap