1B4U


Conserved Protein Domain Family
PCA_45_Doxase_A_like

?
cd07921: PCA_45_Doxase_A_like 
Click on image for an interactive view with Cn3D
Subunit A of the Class III Extradiol dioxygenase, Protocatechuate 4,5-dioxygenase, and similar enzymes
This subfamily includes the A subunit of protocatechuate (PCA) 4,5-dioxygenase (LigAB) and two subfamilies of unknown function. The A subunit is the smaller, non-catalytic subunit of LigAB. PCA 4,5-dioxygenase catalyzes the oxidization and subsequent ring-opening of PCA (or 3,4-dihydroxybenzoic acid), which is an intermediate in the breakdown of lignin and other compounds. PCA 4,5-dioxygenase is one of the aromatic ring opening dioxygenases which play key roles in the degradation of aromatic compounds. As members of the Class III extradiol dioxygenase family, the enzymes use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. LigAB-like class III enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit.
Statistics
?
PSSM-Id: 153391
View PSSM: cd07921
Aligned: 6 rows
Threshold Bit Score: 165.329
Threshold Setting Gi: 148254192
Created: 21-Apr-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
dimer interfaceactive sitetetramer
Conserved site includes 33 residues -Click on image for an interactive view with Cn3D
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Structure:1B4U; Interface between subunits A (1B4U_A) and B (1B4U_B) of Sphingomonas paucimobilis LigAB heterodimer; contacts at 4A.
    View structure with Cn3D
  • Comment:The active site is located at the intersubunit interface. Most active site residues are from the B subunit.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1        #####    #   #   #  #  #    #                             #  #    ####  #  #  ##
1B4U_A        22 GTRVFTAQRARKGYNLNQFAMSLMKAENRERFKADESAYLDEWNLTPAAKAAVLARDYNAMIDEGGNVYFLSKLFSTDGK 101 Sphingomonas pa...
YP_001238777  12 GTTIFDGEQARKGYALNKMCYSFNDAANRKAFVADEDAYCTKFGLNAQQRAAIKHRNVLELIEAGGNAYYLAKFAGIFGL 91  Bradyrhizobium ...
ZP_01115429   10 GTYVMDSKHCRAGYHLNMFCMSLNKAENREAFKADEAAYLDKFSMTLEQKQAVLDRDWLGMLQLGGNIYYTFKIAAFDGR 89  Reinekea sp. ME...
YP_003135608   8 GTHVFDAESSRRSYKLNKMFMSLRDPAARERFSADEAGYCDEFGLTPEQKQAVLDRDWKKMLDLGSSIFYVLKLAMIDKK 87  Saccharomonospo...
YP_572386     12 GTYVFDLALSRQGYAINKMCNSLKFDENREAFKADEEAYMERYGLSEEQKQAVRERDWLRLTQLGGNLFFFLKLGATLGY 91  Chromohalobacte...
ZP_01011786   13 GTFVFDADRSRQGYWLNQFCISLSKEENRQAFRDDPEAHMAKFKMTEDQKQAIRDRDWNRLLELGGNIYYTSKLGAFDGI 92  Rhodobacterales...
Feature 1         ##  #  ##      #   ######
1B4U_A       102 SFQFAAGSMTGMTQEEYAQMMIDGGR 127 Sphingomonas paucimobilis
YP_001238777  92 DMQDIGAQQTGLTKDQFKAKLLAARG 117 Bradyrhizobium sp. BTAi1
ZP_01115429   90 SMQYVGGKMSGVSEEEFRQMMVSGGR 115 Reinekea sp. MED297
YP_003135608  88 SMQYLGGVFTGMTEEEFVAMMRAGGR 113 Saccharomonospora viridis DSM 43017
YP_572386     92 GLYTIGAQMRGESYEQFMSTRNVPGA 117 Chromohalobacter salexigens DSM 3043
ZP_01011786   93 VFQDLAAMMSGMSRDDYRKMMVDGGR 118 Rhodobacterales bacterium HTCC2654

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap