Conserved Protein Domain Family
Tweety_N

?
cd07912: Tweety_N 
N-terminal domain of the protein encoded by the Drosophila tweety gene and related proteins, a family of chloride ion channels.
The protein product of the Drosophila tweety (tty) gene is thought to form a trans-membrane protein with five membrane-spanning regions and a cytoplasmic C-terminus. This N-terminal domain contains the putative transmembrane spanning regions. Tweety has been suggested as a candidate for a large conductance chloride channel, both in vertebrate and insect cells. Three human homologs have been identified and designated TTYH1-3. TTYH2 has been associated with the progression of cancer, and Drosophila melanogaster tweety has been assumed to play a role in development. TTYH2, and TTYH3 bind to and are ubiquinated by Nedd4-2, a HECT type E3 ubiquitin ligase, which most likely plays a role in controlling the cellular levels of tweety family proteins.
Statistics
?
PSSM-Id: 143653
View PSSM: cd07912
Aligned: 15 rows
Threshold Bit Score: 431.366
Threshold Setting Gi: 74872818
Created: 2-Oct-2008
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative pore
Feature 1:putative pore region
Evidence:
  • Comment:a pair of conserved positive charges has been implicated in anion selectivity and conductance

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
Q9U6L4        10 QYKVPVIAKLLHALPHYNITFHKINSTFRPN----------------DEIYLESLGILGSVPAALLIVSLLGLLFYLMTR 73   fruit fly
NP_001080592   7 EYIAPWWVYWLHNLPHVDFSLQRESGDFNPK----------------DPGYQQTLLFVALFIALCAAVNLLFVSGYLICL 70   African clawed...
Q9BSA4         7 DYIAPWWVVWLHSVPHVGLRLQPVNSTFSPG----------------DESYQESLLFLGLVAAVCLGLNLIFLVAYLVCA 70   human
NP_998421      7 DYIAPWWTYWLHNFPHLNFNFQTVDNTFKPE----------------DASYQQSLVFLACVSAVALGLCLLLLSVYLTCL 70   zebrafish
Q0V9V9         6 GYRASWWTYILHQVPHTNFQFEVVDNQFAPQ----------------EWPYQQALLFLASIAGLCLAISLILICVYLIRF 69   western clawed...
NP_001005367   6 GYRPSAWVHLLHQLPRADFQLRPVPSVFAPQ----------------EQEYQQALLLVAALAGLGLGLSLIFIAVYLIRF 69   human
XP_002423897   5 QYKPTVLAKIFHKLPHFNITLHFVNATFNPD----------------SETYLESLGILASIPAAWVILTLFVLLVYLCTR 68   human body louse
XP_396803     10 QYTVPQLAKVFHGLPHLNVSLHSVNNTFNPH----------------SEIYLESLGILGSIPAAWLILTLLVLLVYLVTR 73   honey bee
XP_969203      9 AYSIPFLARLLHSLPHLNVTFHQVNNSFDPH----------------SPVYLESLGILGSLPAAWLILTLLVLLIYLLTR 72   red flour beetle
Q9W5A5         1 MEQPSILVKILHSIPHVNYTFRRVNDTFNPDsdvyleptnnklqcqqKGIELQSLVILASIPAGLLIGSLLGLLLYLLTR 80   fruit fly
Feature 1                                                                                        
Q9U6L4        74 CCDRKP------RPAHSITSLKVALSIVTVMCCAAIGLGLYGNDDLHNGLLEVLTAGRKVDNLVTTIRNQTHILENTLTN 147  fruit fly
NP_001080592  71 CCCKKEde--teTKMTSSCCVTWTAAVSGLLCCAAVGIGFYGNSETNDGVYQLTYSLDNANHTLAGIDSLVSNTNAKMKE 148  African clawed...
Q9BSA4        71 CHCRRDda--vqTKQHHSCCITWTAVVAGLICCAAVGVGFYGNSETNDGAYQLMYSLDDANHTFSGIDALVSGTTQKMKV 148  human
NP_998421     71 CCCRREed--eeVKRPDTCCVTWAAVITGLVICSAVGVGFYGNSETNDGVYQLTYSIYNANHTLGGIGSMVGNSLGSMQV 148  zebrafish
Q0V9V9        70 CCCSSQed--ddSKSHRVCCVTWSCVAAVIICCAGIGIGFYGNSETNDGVYQVTYSLMNANHTLTSINLLISDTVELLSS 147  western clawed...
NP_001005367  70 CCCRPPeppgskIPSPGGGCVTWSCIVALLAGCTGIGIGFYGNSETSDGVSQLSSALLHANHTLSTIDHLVLETVERLGE 149  human
XP_002423897  69 CCDRKP------RPKHSISLLKWTLSIFTILCCGAIGVGLYGNDDVHNAVVHFVSAIKAVNEKILAVKNQTGTIESTLQL 142  human body louse
XP_396803     74 CCDRKP------RPRRSITLLKCSLAILALLCSGAVAVGLYGNDDVHNGLVQLVAAAMNVDGILMGVRNQTDTIELILKK 147  honey bee
XP_969203     73 CCDRKP------RPSRSISALKVSLAIVSVLCCAAIGLGLYGNDDLHNGVVRLLEEGRQVDILVAKIRNQTEAIERQLRV 146  red flour beetle
Q9W5A5        81 CCDRRQ------RKPSAQRCQSCSLVIITLMTCAAIGLGLYGNDDFHNGLLQAFGSGKSVEGLVLTLKRQTESIKHDLET 154  fruit fly
Feature 1                                                                                        
Q9U6L4       148 RIRp-qLVELADIFDqpvsnqtalsklfVSLNIVQGNVTLATNAASDIrrp-----------lmGISMTHFLTRGDQWEL 215  fruit fly
NP_001080592 149 DLDq-hLFRLNEIFAar----------gDYIQSLRFMQQMAGNIIQQLtslpn-------wqgtSVNFSEIARNASIIEY 210  African clawed...
Q9BSA4       149 DLEq-hLARLSEIFAar----------gDYLQTLKFIQQMAGSVVVQLsglpv-------wrevTMELTKLSDQTGYVEY 210  human
NP_998421    149 GLKe-hLERLDEIFSpr----------gDYTQTLRFMQQMADNIIQQLtampe-------trkvQVDLAAIADRTAFIEY 210  zebrafish
Q0V9V9       148 VVRs-dLTQLEEIFSkr----------tEFLVMIRNTRRQVESVAQQLaeisf-------wkgpEPNPNALAEQVNFIED 209  western clawed...
NP_001005367 150 AVRt-eLTTLEEVLEpr----------tELVAAARGARRQAEAAAQQLqglaf-------wqgvPLSPLQVAENVSFVEE 211  human
XP_002423897 143 KVKp-lLAELSDIFDdpva------nqtARAMLLVGLNAVVGNTSSALassldi-----srplqGINLRTIIHYVQLGET 210  human body louse
XP_396803    148 KIQp-qLTALGDEFDapvs------nktMLGLLLTALQSMKQNTNIAVnrsfei-----rkplsGISLAGAIGMAVKIEQ 215  honey bee
XP_969203    147 QVEa-qLVNMRDIFDepvsnmsmfkpalNYLEKTMGNNTMAANAAQDIrqp-----------llGMNLMPKIVVGEKVEA 214  red flour beetle
Q9W5A5       155 RMAghkVEQLVEKPHynq-------tvvMLLIETSRLVTENTSRAVASldsmvhyfmkakgsenDTSLMGLLQLGEFYES 227  fruit fly
Feature 1                                                                                        
Q9U6L4       216 IRWPGTVATLALLLVLCAVLLVGVARHSRCALILFSVCGLLAVTGSWLMSGLYLSSSVAVGDLCISPADFLVStap--rd 293  fruit fly
NP_001080592 211 YRWLSYLILFITDVVICLVTCLGLAKKSKCLLLTMLCCGLIALMLSWASLALETSSAVGTSDFCVAPDKFILNmtp--dq 288  African clawed...
Q9BSA4       211 YRWLSYLLLFILDLVICLIACLGLAKRSKCLLASMLCCGALSLLLSWASLATDGAAAVATSDFCVAPDTFILNvte--gq 288  human
NP_998421    211 YRWLTYLLLLILDLVICLLACLALAKQSRWLLTVIMVCGMLTLIMSWASLGAGTATAVGTSDFCVSPDKYIVNqtk--gt 288  zebrafish
Q0V9V9       210 YRWLAYILLLLLDLIICLFTLLGLAKQIKWLVIVMTVVSFFVLLLSWGSMGLEMATAVGLSDFCSDPDAYVMNqtqaitn 289  western clawed...
NP_001005367 212 YRWLAYVLLLLLELLVCLFTLLGLAKQSKWLVIVMTVMSLLVLVLSWGSMGLEAATAVGLSDFCSNPDPYVLNltqeetg 291  human
XP_002423897 211 IRWPATMGVLSLLLVFCVILLFGVARHSRCCLITFSVFGLFAVIINWMLTSVYLAISVALGDLCVAPEDFLRYesp--ss 288  human body louse
XP_396803    216 LRWPITMAVLSALLVLCVVLVVGVARHSRCVLITFSVFGLFAVIVSWLMASLYLATSVALGDLCVSPDGYLTRavp--st 293  honey bee
XP_969203    215 IRWPLTMAVLSVLLILCVILLVGVARHSRCALIAFSVCGLLAVIASYLMASVYLASSVALGDLCIAPDKFVEDqas--te 292  red flour beetle
Q9W5A5       228 IRWPATLAFLTVLLLLCTVLVIGVARRSRCTLIFFSVSGLFCIIICWLLAGVYLASSVAAGDFCMRPHDYMCRqv----g 303  fruit fly
Feature 1                                                                                        
Q9U6L4       294 LPTNVLLHYTQCEPGhtNPFTQRLRe-------SQNSLNNARsamatvmkislvlfkssgLQPKLGAVNADLNSSERl-- 364  fruit fly
NP_001080592 289 ITADVVHYYLYCSQSqrNPFQQALTv-------FQRSLTTMQiqiqgllq--favplfptAQKDLLGIQLLLNTSESn-- 357  African clawed...
Q9BSA4       289 ISTEVTRYYLYCSQSgsSPFQQTLTt-------FQRALTTMQiqvagllq--favplfstAEEDLLAIQLLLNSSESs-- 357  human
NP_998421    289 LSSDIVHYYLYCSQSlpNPFQQSLTi-------FQRSLTTMQiqvqgllq--favvvfptAEKDLLGIQRLLNSSEFn-- 357  zebrafish
Q0V9V9       290 INPDILQYYISCNQDvtNPFRQRLTm-------SQRALSNIHsqlhgler--eavpqfptAEKNLLVVQGMLNTTEGn-- 358  western clawed...
NP_001005367 292 LSSDILSYYLLCNRAvsNPFQQRLTl-------SQRALANIHsqllgler--eavpqfpsAQKPLLSLEETLNVTEGn-- 360  human
XP_002423897 289 LQAEVLKYYMRCEPShtNPFTQRLRe-------AQRGVDAMTanlgvvakladqlyhkndLHPRLDILTKDINLTDKl-- 359  human body louse
XP_396803    294 LASEVLSYYTHCENTrsNPFSHKLNd-------GQIAASNMKenmntvtrlalelfkeqqLQPKLNSLSIDVNTVSKl-- 364  honey bee
XP_969203    293 LSKDILRYYTSCERAraNPFTQRLRe-------AKTAIENMRsnlnslrqpalnlfpkkqLDTKFSSLKNEVNSADTs-- 363  red flour beetle
Q9W5A5       304 MRSPYVDFLNCGTPR--NRFILRLNesrdlvdrARESVEHMQrmsq----------etypHIDIQRTLNAMDNDLEItlr 371  fruit fly
Feature 1                   #  #                                                   
Q9U6L4       365 -LTQLTALVDCKAVHHNFLAAARGLCEGGLLGLVLMLIASFIAAILLTIMVWVDSHTWIYIRKRND 429  fruit fly
NP_001080592 358 -LHQITALLDCRGLHKDYLEALIGICYDGVEGLLYLSLFSLLAAVAFTAMVCAMPRAWKHLAARDR 422  African clawed frog
Q9BSA4       358 -LHQLTAMVDCRGLHKDYLDALAGICYDGLQGLLYLGLFSFLAALAFSTMICAGPRAWKHFTTRNR 422  human
NP_998421    358 -LHQLTALLDCRSLHKDYLEALLGVCYDGVEGLLYLCLFSLLAACAFCALLCAVPRAWMLIAIRDR 422  zebrafish
Q0V9V9       359 -FHHLVALLNCRGLHKDYVDALKGLCYDGMEGILFLLLFSFLSALSFTAAICSLPRAWKRFQNRDL 423  western clawed frog
NP_001005367 361 -FHQLVALLHCRSLHKDYGAALRGLCEDALEGLLFLLLFSLLSAGALATALCSLPRAWALFPPRNP 425  human
XP_002423897 360 -VSSLAALLDCRPLHKQYLEAVRSVCDLGLYGMAFMLLASISAGLLFTVLVWVDSHTWIYIRKRRD 424  human body louse
XP_396803    365 -MSGLTTLFDCKPLHKQYVHAAKSLCHLGLYGLTFMLLASLAAGLFFTVLVGVDSHTWIYIRKRRD 429  honey bee
XP_969203    364 -VTILTTSVDCRALHAHYLRGARALCNVGLLGLTMMLVSAVLAGLLLTALVWVDSHTWIYIRKRKD 428  red flour beetle
Q9W5A5       372 nLTTLSATLDRRTIDMHYEEALRGLCGGGLLGLSLMMVAGLLTSFLLTILVYADSHAWIYLTKRPT 437  fruit fly

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap