3COI


Conserved Protein Domain Family
STKc_p38delta

?
cd07879: STKc_p38delta 
Click on image for an interactive view with Cn3D
Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase (also called MAPK13)
STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. p38delta/MAPK13 is found in skeletal muscle, heart, lung, testis, pancreas, and small intestine. It regulates microtubule function by phosphorylating Tau. It activates the c-jun promoter and plays a role in G2 cell cycle arrest. It also controls the degration of c-Myb, which is associated with myeloid leukemia and poor prognosis in colorectal cancer. p38delta is the main isoform involved in regulating the differentiation and apoptosis of keratinocytes. p38 kinases are MAPKs, serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. The p38delta subfamily is part of a larger superfamily that includes the catalytic domains of other STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 143384
View PSSM: cd07879
Aligned: 4 rows
Threshold Bit Score: 685.095
Threshold Setting Gi: 47222755
Created: 24-Sep-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 37 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                              #### # ##            # #                #    #        # # 
3COI_A        10 FYKQDVnkTAWELPKTYVSPThVGSGAYGSVCSAIDKrsGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLL 89  human
NP_001116942   9 FRKEEVnkTLWEIPLRYASLClVGSGAYGSVCSAIDLktGEKVAIKKLSRPFQSEIFAKRAFRELTLLKHMNHENVIGLL 88  western clawed ...
XP_001234443   9 FYRQELnrTIWELPRRYTSLHpVGSGAYGSVCSAIDKktGEKVAIKKLCRPFQSEIFAKRAYRELTLLKQMQHENVIGLL 88  chicken
CAG01722       1 FSREEInnTVWEVPEKYTRLKqIGTGAYGSVCSAINErtKEKVAIKKLHRPFQSEIFAKRAYRELRLLKHMKHENVSRWR 80  spotted green p...
Feature 1                                   # ####  # ##                                 # # ## #
3COI_A        90 DVFTPassl-----------rnfYDFYLVMPFMQTDLQKIMGlKFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLA 158 human
NP_001116942  89 DVFTSatsf-----------ndfHNFYLVMPYMQIDLQKIMGhHLSEDKVQYLVYQMLCGLKYIHAAGIIHRDLKPGNLA 157 western clawed ...
XP_001234443  89 DVFTSapsy-----------hgfQDFYLVMPYMRTDLQKIMGhEFSDEKIQYLVYQMLKGLKYIHSAGIIHRDLKPGNLA 157 chicken
CAG01722      81 QRQVSqviglidvftpasgldemQDFYLVMPYMFTDLSKVRG-PLSEDKVQFLIYQTLCGLRYIHKSGIIHRDLKPGNLA 159 spotted green p...
Feature 1                 ## ##        # #### #                                     #            
3COI_A       159 VNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILK 238 human
NP_001116942 158 VNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILNWMHYNKTVDIWSVGCIMGEMLTGKTLFKGKDYLDQLTQILK 237 western clawed ...
XP_001234443 158 VNEDCQLKILDFGLARHADAEMTGYVVTRWYRAPEVILNWMHYNQTVDIWSIGCIMAEMLTGKTLFKGKDYVDQLTQILK 237 chicken
CAG01722     160 VNQDCELKILDFGLARSADAEMTGYVVTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMINGKTLFKGKDYMDQLTQIMK 239 spotted green p...
Feature 1                                                                                        
3COI_A       239 VTGVPGTEFVQKLndKAAKSYIQSLPQTPRKDFTQLFPRaSPQAADLLEKMLELDVDKRLTAAQALTHPFFePFRDPEEE 318 human
NP_001116942 238 VTGVPGPEFIQKLedMAAKKYIQSLPKIPKKEFSLLFPNaSDLAVDLLEKMLELDVEKRLTATEALEHPYFdEFHDADEE 317 western clawed ...
XP_001234443 238 VTGHPGDDFVEKLedKAAKSYIKSLPKMPKKDLSVLFPTaNPQAVDLLDKMLQLDVEKRLTATEALAHPYFdQFRDIEEE 317 chicken
CAG01722     240 VTGVPGPEFVQKLdsIEAKNYVKALPRYPRKDFSTLFPKaSANGIDLLEKMLVLDGDERLTADLALEHPYFdSLRDADDF 319 spotted green p...
Feature 1                                          
3COI_A       319 TeaqQPFDDSLEHekLTVDEWKQHIYKEIVNFSP 352 human
NP_001116942 318 Te-aPPYDDSLEGekLSVEEWRKYTYEEVINYTP 350 western clawed frog
XP_001234443 318 TeaqQSYDDSLERekLSIEEWKKHIYKEILSFSP 351 chicken
CAG01722     320 Pe-pTPYDDSHDNatLSLDEWKRLCFREVKSFVP 352 spotted green pufferfish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap