2FST,1LEZ,1ZZ2,1BL7,1LEW,2NPQ,1YWR,3HVC,3NEW,3PY3


Conserved Protein Domain Family
STKc_p38alpha

?
cd07877: STKc_p38alpha 
Click on image for an interactive view with Cn3D
Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase (also called MAPK14)
STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. p38alpha/MAPK14 is expressed in most tissues and is the major isoform involved in the immune and inflammatory response. It is the central p38 MAPK involved in myogenesis. It plays a role in regulating cell cycle check-point transition and promoting cell differentiation. p38alpha also regulates cell proliferation and death through crosstalk with the JNK pathway. Its substrates include MAPK activated protein kinase 2 (MK2), MK5, and the transcription factors ATF2 and Mitf. p38 kinases MAPKs, serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. The p38alpha subfamily is part of a larger superfamily that includes the catalytic domains of other STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 143382
View PSSM: cd07877
Aligned: 13 rows
Threshold Bit Score: 771.517
Threshold Setting Gi: 326327986
Created: 24-Sep-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 23 residues -Click on image for an interactive view with Cn3D
Feature 1:ATP binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                ##   # ##            # #                     #        # 
2FST_X        13 PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIG 92  human
1LEZ_A         6 PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIG 85  house mouse
1ZZ2_A         6 PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIG 85  human
1BL7_A        25 PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIG 104 human
1LEW_A         6 PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIG 85  house mouse
2NPQ_A        13 PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIG 92  human
1YWR_A         6 PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIG 85  house mouse
3HVC_A         8 PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIG 87  human
P47812         7 YVFYRQELNKTLWEVPDRYQNLTPVGSGAYGSVCSSFDTRTALRIAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIG 86  African clawed ...
Q9DGE2         7 PTFYRQEVNKTIWEVPVQYQNLSPVGSGAYGSVCSAFDAKTGFKVAVKKLSRPFQSIIHAKRTYRELRLLKHMRHENVIG 86  zebrafish
XP_001232616   6 PKFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCSAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIG 85  chicken
3NEW_A        12 PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIG 91  human
3PY3_A        26 PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIG 105 house mouse
Feature 1        #                 # ####  #                                     # # ##          
2FST_X        93 LLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELK 172 human
1LEZ_A        86 LLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELK 165 house mouse
1ZZ2_A        86 LLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELK 165 human
1BL7_A       105 LLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELK 184 human
1LEW_A        86 LLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELK 165 house mouse
2NPQ_A        93 LLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELK 172 human
1YWR_A        86 LLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELK 165 house mouse
3HVC_A        88 LLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELK 167 human
P47812        87 LLDVFSPAKSFEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSAGIIHRDLKPSNLAVNEDCELK 166 African clawed ...
Q9DGE2        87 LLDVFTPATSLKEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELK 166 zebrafish
XP_001232616  86 LLDVFTPAKSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELK 165 chicken
3NEW_A        92 LLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDSELK 171 human
3PY3_A       106 LLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELK 185 house mouse
Feature 1         ## #                                                                           
2FST_X       173 ILDFGLARHTADEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAE 252 human
1LEZ_A       166 ILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAE 245 house mouse
1ZZ2_A       166 ILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAE 245 human
1BL7_A       185 ILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAE 264 human
1LEW_A       166 ILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAE 245 house mouse
2NPQ_A       173 ILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAE 252 human
1YWR_A       166 ILDFGLARHTDDEMAGFVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAE 245 house mouse
3HVC_A       168 ILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAE 247 human
P47812       167 ILDFGLARHTDEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPEPE 246 African clawed ...
Q9DGE2       167 ILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNVTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPSS 246 zebrafish
XP_001232616 166 ILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGPE 245 chicken
3NEW_A       172 ILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAE 251 human
3PY3_A       186 ILDFGLARHTDDEMXGXVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAE 265 house mouse
Feature 1                                                                                        
2FST_X       253 LLKKIsSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFaQYHDPDDEPvaDPYDQ 332 human
1LEZ_A       246 LLKKIsSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFaQYHDPDDEPvaDPYDQ 325 house mouse
1ZZ2_A       246 LLKKIsSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFaQYHDPDDEPvaDPYDQ 325 human
1BL7_A       265 LLKKIsSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFaQYHDPDDEPvaDPYDQ 344 human
1LEW_A       246 LLKKIsSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFaQYHDPDDEPvaDPYDQ 325 house mouse
2NPQ_A       253 LLKKIsSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFaQYHDPDDEPvaDPYDQ 332 human
1YWR_A       246 LLKKIsSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFaQYHDPDDEPvaDPYDQ 325 house mouse
3HVC_A       248 LLKKIsSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFaQYHDPDDEPvaDPYDQ 327 human
P47812       247 LLQKIsSEAARNYIQSLPYMPKMNFEDVFLGANPQAVDLLEKMLVLDTDKRITAAEALAHSYFaQYHDPDDEPiaEPYDQ 326 African clawed ...
Q9DGE2       247 LISRMpSHEARTYISSLPQMPKRNFADVFIGANPQAVDLLEKMLVLDTDKRITAAEALAHPYFaQYHDPDDEPeaEPFDQ 326 zebrafish
XP_001232616 246 LLKKIsSESARNYIQSLSYMPKMNFENVFIGANPLAVDLLEKMLVLDTDKRITAAEALAHAYFaQYHDPDDEPvaDPYDQ 325 chicken
3NEW_A       252 LLKKIsSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFaQYHDPDDEPvaDPYDQ 331 human
3PY3_A       266 LLKKIsSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFaQYHDPDDEPvaDPYDQ 345 house mouse
Feature 1                                 
2FST_X       333 SLESRDLLIDEWKSLTYDEVISFVP 357 human
1LEZ_A       326 SFESRDLLIDEWKSLTYDEVISFVP 350 house mouse
1ZZ2_A       326 SFESRDLLIDEWKSLTYDEVISFVP 350 human
1BL7_A       345 SFESRDLLIDEWKSLTYDEVISFVP 369 human
1LEW_A       326 SFESRDLLIDEWKSLTYDEVISFVP 350 house mouse
2NPQ_A       333 SFESRDLLIDEWKSLTYDEVISFVP 357 human
1YWR_A       326 SFESRDLLIDEWKSLTYDEVISFVP 350 house mouse
3HVC_A       328 SFESRDLLIDEWKSLTYDEVISFVP 352 human
P47812       327 SFESRELDIEEWKRLTYEEVTCFVP 351 African clawed frog
Q9DGE2       327 SFESRELDIEEWKRQTYEEMISFEP 351 zebrafish
XP_001232616 326 SFESRELEIEEWKSLTYDEVISFVP 350 chicken
3NEW_A       332 SFESRDLLIDEWKSLTYDEVISFVP 356 human
3PY3_A       346 SFESRDLLIDEWKSLTYDEVISFVP 370 house mouse

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap