1JNK,2B1P


Conserved Protein Domain Family
STKc_JNK3

?
cd07874: STKc_JNK3 
Click on image for an interactive view with Cn3D
Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3
STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in JNK3 are protected against kainic acid-induced seizures, stroke, sciatic axotomy neural death, and neuronal death due to NGF deprivation, oxidative stress, or exposure to beta-amyloid peptide. This suggests that JNK3 may play roles in the pathogenesis of these diseases. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 143379
View PSSM: cd07874
Aligned: 5 rows
Threshold Bit Score: 729.964
Threshold Setting Gi: 166796029
Created: 24-Sep-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 25 residues -Click on image for an interactive view with Cn3D
Feature 1:ATP binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                ####### #            # #                              # 
1JNK_A        46 NQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIS 125 human
2B1P_A         1 NQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIS 80  human
XP_420551     36 NQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIS 115 chicken
NP_001107691  46 NQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIS 125 western clawed ...
AAI39643       8 NQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAGYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIS 87  zebrafish
Feature 1        #                 # #### ##  #                                   # ## #         
1JNK_A       126 LLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKI 205 human
2B1P_A        81 LLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKI 160 human
XP_420551    116 LLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKI 195 chicken
NP_001107691 126 LLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKI 205 western clawed ...
AAI39643      88 LLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHGRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKI 167 zebrafish
Feature 1        #                                                                               
1JNK_A       206 LDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPE 285 human
2B1P_A       161 LDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPE 240 human
XP_420551    196 LDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDMWSVGCIMGEMVKGAVLFPGTDHIDQWNKVIEQLGTPCPE 275 chicken
NP_001107691 206 LDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPE 285 western clawed ...
AAI39643     168 LDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPSPE 247 zebrafish
Feature 1                                                                                        
1JNK_A       286 FMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDP 365 human
2B1P_A       241 FMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDP 320 human
XP_420551    276 FMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDEALQHPYINVWYDP 355 chicken
NP_001107691 286 FMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDEALQHPYINVWYDP 365 western clawed ...
AAI39643     248 FMKKLQPTVRNYVENRPKYAGLTFPKLFPDCLFPADSEHNKLKASQARDLLSKMLIIDPAKRISVDEALQHPYINVWYDP 327 zebrafish
Feature 1                                                              
1JNK_A       366 AEVEA-------------------PPPQIYDKQLDEREHTIEEWKELIYKEVMN 400 human
2B1P_A       321 AEVEA-------------------PPPQIYDKQLDEREHTIEEWKELIYKEVMN 355 human
XP_420551    356 AEVEA-------------------PPPQIYDKQLDEREHTIEEWKELIYKEVMN 390 chicken
NP_001107691 366 SEVEAgplrdiwneqpvktknnekPPPQIYDKQLDEREHTIEEWKELIYKEVMN 419 western clawed frog
AAI39643     328 AEVEA-------------------PPPQIYDKQLDEREHSIDEWKELIYKEVMN 362 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap