Conserved Protein Domain Family
STKc_PCTAIRE2

?
cd07872: STKc_PCTAIRE2 
Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase
STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. PCTAIRE-2 is specifically expressed in neurons in the central nervous system, mainly in terminally differentiated neurons. It associates with Trap (Tudor repeat associator with PCTAIRE-2) and could play a role in regulating mitochondrial function in neurons. PCTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. The PCTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 143377
View PSSM: cd07872
Aligned: 4 rows
Threshold Bit Score: 642.427
Threshold Setting Gi: 55962513
Created: 24-Sep-2008
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                  ####    #            # #               #             #             
O35831    185 GFGKMETYIKLEKLGEGTYATVYKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIVHTDKSLT 264 Norway rat
AAH43763  162 GFGKMETYVKLEKLGEGTYATVFKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIVHTDKSLT 241 African clawed frog
XP_416161 185 GFGKMETYIKLEKLGEGTYATVYKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIVHTDKSLT 264 chicken
CAI11763  188 GFGKLETYIKLDKLGEGTYATVFKGRSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIVHTDKSLT 267 zebrafish
Feature 1       ####  # ##                                    # # ## #          #  #          
O35831    265 LVFEYLDKDLKQYMDDCGSIMSMHNVKLFLYQILRGLAYCHRRKVLHRDLKPQNLLINERGELKLADFGLARAKSVPTKT 344 Norway rat
AAH43763  242 LVFEYLDKDLKQYMDDCGNIMSIHNVKIFLYQILRGLAYCHKRKVLHRDLKPQNLLINEKGELKLADFGLARAKSVPTKT 321 African clawed frog
XP_416161 265 LVFEYLDKDLKQYMDDCGNIMSMHNVKLFLYQILRGLAYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSVPTKT 344 chicken
CAI11763  268 LVFEYLDKDLKQYMDDCGNIMSMHNVKIFLFQILRGLAYCHRRKVLHRDLKPQNLLINERGELKLADFGLARAKSVPTKT 347 zebrafish
Feature 1      # #### #                                     ##                                
O35831    345 YSNEVVTLWYRPPDVLLGSSEYSTQIDMWGVGCIFFEMASGRPLFPGSTVEDELHLIFRLLGTPSQETWPGVSSNDEFKN 424 Norway rat
AAH43763  322 YSNEVVTLWYRPPDVLLGSSEYSTQIDMWGVGCIFFEMASGRPLFPGSTVEDELHLIFRLLGTPAEETWPGISSNDEFRN 401 African clawed frog
XP_416161 345 YSNEVVTLWYRPPDVLLGSSEYSTQIDMWGVGCIFFEMASGRPLFPGSTVEDELHLIFRLLGTPCQETWPGISSSDEFRN 424 chicken
CAI11763  348 YSNEVVTLWYRPPDVLLGSSEYSTQIDMWGVGCIFYEMAAGRPLFPGSTVEDELHLIFRLLGTPTEDNWPGISSIEEFKS 427 zebrafish
Feature 1                                                                          
O35831    425 YNFPKYKPQPLINHAPRLDSEGIELITKFLQYESKKRAPAEEAMKHVYFRSLGPRIHALPESVSIFSLK 493 Norway rat
AAH43763  402 YNFPKYKPQPLINHAPRLDSEGIELLTRFLQYESKKRISAEDAMKHAYFRSLGTKLHSLPENISIFSLK 470 African clawed frog
XP_416161 425 YNFPKYKPQPLINHAPRLDTEGIELIAKFLQYESKKRISAEEAMKHAYFRSLGTRIHSLPESVSIFSLK 493 chicken
CAI11763  428 YNFPKYKPQPFINHAPRLDTEGIELLLSFLRYESKKRISADESMKHSYFKSLGMRIHTLPESISIFTLK 496 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap