Conserved Protein Domain Family
STKc_PFTAIRE1

?
cd07869: STKc_PFTAIRE1 
Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase
STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. PFTAIRE-1 is widely expressed except in the spleen and thymus. It is highly expressed in the brain, heart, pancreas, testis, and ovary, and is localized in the cytoplasm. It is regulated by cyclin D3 and is inhibited by the p21 cell cycle inhibitor. It has also been shown to interact with the membrane-associated cyclin Y, which recruits the protein to the plasma membrane. PFTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. The PFTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 143374
View PSSM: cd07869
Aligned: 3 rows
Threshold Bit Score: 606.305
Threshold Setting Gi: 148236379
Created: 24-Sep-2008
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                    ####    #            # #               #             #              
O94921       129 FGKADSYEKLEKLGEGSYATVYKGKSKVNGKLVALKVIRLQEEEGTPFTAIREASLLKGLKHANIVLLHDIIHTKETLTL 208 human
NP_001086352  95 FGKADSYEKLEKLGEGSYATVFKGKSKVNGKLVALKVIRLQEEEGTPFTAIREASLLKGLKHANIVLLHDIIHTKETLTL 174 African clawed ...
XP_418647    433 FGKADSYEKLEKLGEGSYATVYKGKSKVNGKLVALKVIRLQEEEGTPFTAIREASLLKGLKHANIVLLHDIIHTKETLTL 512 chicken
Feature 1         ####  # ##                                    # # ## #          #  #           
O94921       209 VFEYVHTDLCQYMDKHPGGLHPDNVKLFLFQLLRGLSYIHQRYILHRDLKPQNLLISDTGELKLADFGLARAKSVPSHTY 288 human
NP_001086352 175 VFEYVHTDLCQYMDKHPGGLNPENVKLFLFQLLRGLSYIHQGHILHRDLKPQNLLISDTGELKLADFGLARAKSVPSHTY 254 African clawed ...
XP_418647    513 VFEYVHTDLCQYMDKHPGGLHPENVKLFLFQLLRGLSYIHQRYILHRDLKPQNLLISDTGELKLADFGLARAKSVPSHTY 592 chicken
Feature 1        # #### #                                     ##                                 
O94921       289 SNEVVTLWYRPPDVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDTWPGVHSLPHFKP 368 human
NP_001086352 255 SNEVVTLWYRPPDVLLGSTDYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIFLILGTPIEETWPAVHSLPHFEP 334 African clawed ...
XP_418647    593 SNEVVTLWYRPPDVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDTWPGVHSLPHFKP 672 chicken
Feature 1                                                                       
O94921       369 ERFTLYSSKNLRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAALSHEYFSDLPPRLWELTD 431 human
NP_001086352 335 ERFTLYGPKNLRQAWNKLSYVNHAEDLASKLLQCFPKNRLSAQAALNHDYFSDLPPRLWELSD 397 African clawed frog
XP_418647    673 ERFTQYSPKNLRQAWNKLSYVNHAEDLASKLLQCFPKNRLSAQAALSHEYFSDLPPRLWELTD 735 chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap