Conserved Protein Domain Family
STKc_TDY_MAPK

?
cd07859: STKc_TDY_MAPK 
Catalytic domain of the Serine/Threonine Kinases, Plant TDY Mitogen-Activated Protein Kinases
STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. Plant MAPKs are typed based on the conserved phosphorylation motif present in the activation loop, TEY and TDY. This subfamily represents the TDY subtype and is composed of Group D plant MAPKs including Arabidopsis thaliana MPK18 (AtMPK18), Oryza sativa Blast- and Wound-induced MAPK1 (OsBWMK1), OsWJUMK1 (Wound- and JA-Uninducible MAPK1), Zea mays MPK6, and the Medicago sativa TDY1 gene product. OsBWMK1 enhances resistance to pathogenic infections. It mediates stress-activated defense responses by activating a transcription factor that affects the expression of stress-related genes. AtMPK18 is involved in microtubule-related functions. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs; Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20 while Oryza sativa contains at least 17 MAPKs. Arabidopsis thaliana contains more TEY-type MAPKs than TDY-type, whereas the reverse is true for Oryza sativa. The TDY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 143364
View PSSM: cd07859
Aligned: 12 rows
Threshold Bit Score: 619.105
Threshold Setting Gi: 159491284
Created: 24-Sep-2008
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1               #### ## #            # #                #             #                  
Q8W4J2        24 RYRIEEVIGKGSYGVVCSAYDTHTGEKVAIKKINDIFEHVSDATRILREIKLLRLLRHPDIVEIKHILLPPSRREFRDIY 103 thale cress
AAQ94319      24 RYKIEEVIGKGSYGVVCSAVDTHTGEKVAIKKINDIFEHVSDATRILREIKLLRLLRHPDIVEIKHILLPPSRREFRDIY 103 Zea mays
Q5SN53        12 RYKIQEVIGKGSYGVVCSAIDQHTGDKVAIKKIHNIFEHLSDAARILREIKLLRLLRHPDIVEIKHIMLPPSRRDFKDIY 91  Japanese rice
NP_565070     89 RYQIQEVVGKGSYGVVGSAIDTHTGERVAIKKINDVFDHISDATRILREIKLLRLLLHPDVVEIKHIMLPPSRREFRDVY 168 thale cress
Q6L5D4       106 RYRIQEVIGKGSYGVVCSAIDLHTRQKVAIKKVHNIFEHVSDAARILREIKLLRLLRHPDIVEIKHIMLPPSRRDFKDIY 185 Japanese rice
AAD28617      24 RYKILEVVGKGSYGVVCAAIDTHTGGKVAIKKIHDVFEHISDAIRILREVKLLRLLRHPDIVEIKRIMLPPSKREFKDIY 103 alfalfa
CAL54782      31 RYELLEVIGKGSYGVVCAAIDRESGQKVAIKKVRNAFDHASDATRILREVTLLRHLKHPDIVEVLNIMLPPNPREFNEVF 110 Ostreococcus tauri
XP_001766825  15 RYRILEVIGKGSYGVVCSAVDTLTGEKVAIKKINDIFEHVSDATRILREIKLLRLLRHPDIVEVKHIMLPPSRRDFKDIY 94  Physcomitrella ...
ABK24488      24 RYKIQEVIGKGSYGVVCSAIDTHTGEKVAIKKITNIFEHLSDATRILREIKLLRLLRHPDIVEIKHIMLPPSQREFKDIY 103 Sitka spruce
XP_001703601   3 RYTVHSLIGKGSYGLVCAAKDNLTGEMVAIKKIQNVFDNVADAHRILREITLLRVLRHPDIVEIKHIMLPSDPNTFKDLY 82  Chlamydomonas r...
Q5Z9J0        86 QYQIQEVIGKGSYGVVAAAVDTRTGERVAIKKINDVFEHVSDATRILREIKLLRLLRHPDIVEIKHIMLPPSRREFQDIY 165 Oryza sativa Ja...
Q9C5C0        24 RYRILEVIGKGSYGVVCAAIDTHTGEKVAIKKINDVFEHISDALRILREVKLLRLLRHPDIVEIKSIMLPPSKREFKDIY 103 thale cress
Feature 1          ####  # ##                                   # # ## #         ##  #           
Q8W4J2       104 VVFELMESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTANVFHRDLKPKNILANADCKLKICDFGLARVAFNDTPTA 183 thale cress
AAQ94319     104 VVFELMESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTANVFHRDLKPKNILANADCKLKICDFGLARVAFNDTPTA 183 Zea mays
Q5SN53        92 VVFELMDTDLHQVIKANDDLTKEHHQFFLYQMLRALKYIHTANVYHRDLKPKNILANANCKLKICDFGLARVAFNDTPTT 171 Japanese rice
NP_565070    169 VVFELMESDLHQVIKANDDLTPEHHQFFLYQLLRGLKYVHAANVFHRDLKPKNILANADCKLKICDFGLARVSFNDAPTA 248 thale cress
Q6L5D4       186 VVFELMESDLHQVIKANDDLTKEHYQFFLYQLLRALKYIHTASVYHRDLKPKNILANSNCKLKICDFGLARVAFNDTPTT 265 Japanese rice
AAD28617     104 VVFELMESDLHQVIKANDDLTREHQQFFLYQMLRALKFMHTANVYHRDLKPKNILANANCKLKVCDFGLARVAFNDTPTT 183 alfalfa
CAL54782     111 IVFELMGTDLHQVIKANDDLTDEHHQFFLYQLLRGLKYMHSANVFHRDLKPKNILANSDCKLKICDFGLARAMTAKTGPQ 190 Ostreococcus tauri
XP_001766825  95 VVFELMESDLHQVIKANDDLTPEHYQFFLYQLLRALKYIHTANVFHRDLKPKNVLANADCKLKICDFGLARVAFSDAPTA 174 Physcomitrella ...
ABK24488     104 VVFELMESDLHQVIKANDDLTPEHYQFFLYQLLRALKFIHTANVFHRDLKPKNVLANADCKLKICDFGLARVAFNDTPTA 183 Sitka spruce
XP_001703601  83 VCFELMESDLHTVIGANDDLTADHHKVFLFQLLRGLNFMHSNGVLHRDLKPKNILANSNCKLKICDFGLARPHLLDGAGA 162 Chlamydomonas r...
Q5Z9J0       166 VVFELMESDLHQVIRANDDLTPEHYQFFLYQLLRALKYIHAANVFHRDLKPKNILANSDCKLKICDFGLARASFNDAPSA 245 Oryza sativa Ja...
Q9C5C0       104 VVFELMESDLHQVIKANDDLTREHHQFFLYQMLRALKFMHTANVYHRDLKPKNILANANCKLKVCDFGLARVAFNDTPTT 183 thale cress
Feature 1                # #### #                                      #                         
Q8W4J2       184 -----IFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMTDMLGTPSAeaigRV 258 thale cress
AAQ94319     184 -----IFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIITDLLGTPSPeaisRI 258 Zea mays
Q5SN53       172 -----VFWTDYVATRWYRAPELCGSFFTKYSPAIDIWSIGCIFAEILTGKPLFPGKNVVHQLDLMTDLLGTPSMdtvtRI 246 Japanese rice
NP_565070    249 -----IFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSVGCIFAEMLLGKPLFPGKNVVHQLDIMTDFLGTPPPeaisKI 323 thale cress
Q6L5D4       266 -----VFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGKNVVHQLDLMTDLLGTPSMdtisRV 340 Japanese rice
AAD28617     184 -----TFWTDYVATRWYRAPELCGSFFAKYTPAIDIWSIGCIFAEVLTGKPLFPGKSIVHQLDLITDLLGTPPPeiisGV 258 alfalfa
CAL54782     191 m----IFWTDYVATRWYRAPELCGSFFTKYTPAIDIWGVGCIFAELLRGRPLFPGKNVVKQLELITDLLGTPTPlqiaKV 266 Ostreococcus tauri
XP_001766825 175 -----IFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGKNVVHQLDLMTDMLGSPSSetvqRV 249 Physcomitrella ...
ABK24488     184 -----IFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGKNVVHQLDLMTDLLGTPSQetiaRV 258 Sitka spruce
XP_001703601 163 apltpVLWTDYVATRWYRAPELCGCFYGRYSSAVDMWSIGCIFAEVLLGKPLFPGRDAVHQLQLITDLLGKPPPhvvdAI 242 Chlamydomonas r...
Q5Z9J0       246 -----IFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGRPLFPGKNVVHQLDIITDLLGTPSSetlsRI 320 Oryza sativa Ja...
Q9C5C0       184 -----VFWTDYVATRWYRAPELCGSFFSKYTPAIDVWSIGCIFAEVLTGKPLFPGKSVVHQLELITDLLGTPKSetisGV 258 thale cress
Feature 1                                                                                        
Q8W4J2       259 RNEKARRYLSSMRKKKPIPFSHKFPHtDPLALRLLEKMLSFEPKDRPTaEEALADVYFKGLAKVEREPsaq--pvtKLEF 336 thale cress
AAQ94319     259 RNEKARRYLSSMRRKKPIPFTQKFPNaDPLALCLLERMLAFEPKDRPSaEEALADPYFKNIASVDREPsaq--avtKLEF 336 Zea mays
Q5SN53       247 RNEKARRYLSSMRKKQPVPFSERFPKaDPAALKLLQRLLAFDPKDRPTaEEALADPYFKGLAKAEREPscq--pitKMEF 324 Japanese rice
NP_565070    324 RNDKARRYLGNMRKKQPVPFSKKFPKaDPSALRLLERLIAFDPKDRPSaEEALADPYFNGLSSKVREPstq--pisKLEF 401 thale cress
Q6L5D4       341 RNEKARRYLSSMRKKDPVPFSQKFPNaDPLALKLLQRLLAFDPKDRPTaEEALTDPYFKGLSKIDREPscq--pirKLEF 418 Japanese rice
AAD28617     259 RNEKARKYLMEMRKKLPVPFERKFPNaDPLALRLLQRLLAFDPKDRPTaQEALADPFFKGLAKIEREPssq--pisRMEF 336 alfalfa
CAL54782     267 RNEKARRFLQQMRIKPATPLSEKFPGvDSKALNLLEKLLAFDPDDRPTaAQALADPYFEGLADVSREPsrh--plpKSVF 344 Ostreococcus tauri
XP_001766825 250 RNEKARRYLSTMRKKLPMPFGQKFPNaDPLAIRLLERMLAFDPRDRPTaEEALADPYFKGLAKVDREPsaq--pitKMEF 327 Physcomitrella ...
ABK24488     259 RNEKARRYLNSMRKKQPVPFTQKFVGtDNLALKLLERLLAFDPKDRPTaEEALADPYFRGLARVSREPvaq--pitKMEF 336 Sitka spruce
XP_001703601 243 GNVKARAFLNALEPKRPRQLSSKFPAaDPLALDLLGHLLAFDPADRPTaAEALAHPYFAGLPSAVNQVrgqpsvriADDF 322 Chlamydomonas r...
Q5Z9J0       321 RNEKARRYLSTMRKKHAVPFSQKFRNtDPLALRLLERLLAFDPKDRSSaEEALADPYFASLANVEREPsrh--pisKLEF 398 Oryza sativa Ja...
Q9C5C0       259 RNDKARKYLTEMRKKNPVTFSQKFSKaDPLALRLLQRLLAFDPKDRPTpAEALADPYFKGLSKIEREPssq--qisKMEF 336 thale cress
Feature 1                                 
Q8W4J2       337 EFERRRITKEDVRELIYRESLEYHP 361 thale cress
AAQ94319     337 EFERRRVTKEDIRELIYREILEYHP 361 Zea mays
Q5SN53       325 EFERRKVTKEDVKELIFREILEYHP 349 Japanese rice
NP_565070    402 EFERKKLTKDDIRELIYREILEYHP 426 thale cress
Q6L5D4       419 EFEQKKLSKEDIRELIFQEILEYHP 443 Japanese rice
AAD28617     337 DFERRRVSKDDIKELIYREILEYHP 361 alfalfa
CAL54782     345 AWDQRKLSREEVRELLYEEILHYHP 369 Ostreococcus tauri
XP_001766825 328 EFERRRINKEDVRELIYREILEYHP 352 Physcomitrella patens subsp. patens
ABK24488     337 EFERRRVTKDDVRELIYREILEYHP 361 Sitka spruce
XP_001703601 323 QFESCRLSEGDVRHLIYREALQYHP 347 Chlamydomonas reinhardtii
Q5Z9J0       399 EFERRKLTKDDVRELIYREILEYHP 423 Oryza sativa Japonica Group
Q9C5C0       337 EFERRRLTKDDIRELIYREILEYHP 361 thale cress

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap