Conserved Protein Domain Family
STKc_NLK

?
cd07853: STKc_NLK 
Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase
STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. NLK is an atypical mitogen-activated protein kinase (MAPK) that is not regulated by a MAPK kinase. It functions downstream of the MAPK kinase kinase Tak1, which also plays a role in activating the JNK and p38 MAPKs. The Tak1/NLK pathways are regulated by Wnts, a family of secreted proteins that is critical in the control of asymmetric division and cell polarity. NLK can phosphorylate transcription factors from the TCF/LEF family, inhibiting their ability to activate the transcription of target genes. In prostate cancer cells, NLK is involved in regulating androgen receptor-mediated transcription and its expression is altered during cancer progression. MAPKs are important mediators of cellular responses to extracellular signals. The NLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 173748
View PSSM: cd07853
Aligned: 12 rows
Threshold Bit Score: 653.735
Threshold Setting Gi: 196010211
Created: 27-Jul-2006
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1               #### ## #            # #                #             #                  
AAS66356      87 EMEPDRPIGYGAFGVVWSVTDPRDGRKVALKKMPNVFQNLVSCKRVFRELRMLCFFkHDNVLSALDILQPpqi-dcFEEI 165 zebrafish
AAH68796     129 DIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFkHDNVLSALDILQPphi-dyFEEI 207 African clawed ...
5002208       67 DSQPDRPIGYGAFGVVWSVTDPRSGKRVALKKMPNVFQNLASCKRVFREIKMLSSFrHDNVLSLLDILQPanp-sfFQEL 145 Caenorhabditis ...
AAA21125      39 DVQPDRPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFkHENVLSALDILQPphl-dfFQEI 117 fruit fly
BAE06569       3 IAEPDKPIGYGAFGVVWAVKDPRDGKQVALKKMPNVFHNIMSAKRVLRELKMLCYFnHENVLSAVDVLPPvd--spYEEM 80  Ciona intestinalis
AAS00536      48 EFEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPHVFQNLISCKRVYRELKMLFFFnHDNVLRALDILQPphv-dfFEEI 126 common urchin
BAG49076      62 DIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFkHDNVLSALDILQPphi-dyFEEI 140 zebrafish
NP_001082214  59 DPEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFkHDNVLSALDILQPpqi-dcFEEI 137 African clawed ...
XP_001622627  38 QNHPDRPIGYGAFGVVWSVTDPRNGKRVALKKMPKVFQNITSSRRAYRELRMLCTLkHDNVISAIDIVHPghi-dlFHEI 116 starlet sea ane...
XP_002114970  36 DVQLIRQIGFGSYGVVWSVVDPRNGKKAALKKLVNAFDDYVAIKRALRELKLLCFCrHDNILGAIEVLKTplligpFRHV 115 Trichoplax adha...
Q9UBE8       137 DIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFkHDNVLSALDILQPphi-dyFEEI 215 human
XP_415915    137 DIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFkHDNVLSALDILQPphi-dyFEEI 215 chicken
Feature 1           ####  # ##                                   # # ## #         ##  #          
AAS66356     166 YVITELMQSDLHKVIVSPQPLTTDHIKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCLLKICDFGLARVEEPDPSR 245 zebrafish
AAH68796     208 YVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESR 287 African clawed ...
5002208      146 YVLTELMQSDLHKIIVSPQALTPDHVKVFVYQILRGLKYLHTANILHRDIKPGNLLVNSNCILKICDFGLARTWDQRDRL 225 Caenorhabditis ...
AAA21125     118 YVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLLVNSNCVLKICDFGLARVEEPDQAK 197 fruit fly
BAE06569      81 YVITQLMHTDLHKIIVSQQSLSADHIRLFLYQILRGVKYLHGARILHRDIKPGNLLINSDCRLKICDFGLARLEEPDESK 160 Ciona intestinalis
AAS00536     127 YVVTELLQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKVCDFGLARVEEPDTSK 206 common urchin
BAG49076     141 YVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESR 220 zebrafish
NP_001082214 138 YVITELMQTDLHKVIVSPQPLSSDHIKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESQ 217 African clawed ...
XP_001622627 117 YVVSELMQSDLHKIIVSPQPLTADHVKVFLYQILRGLKYLDSAKILHRDIKPGNLLVNSNCLLKICDFGLARLEEPDESV 196 starlet sea ane...
XP_002114970 116 FVLTDLMQCDLHNVIIRNPRIADEYVKLFTYQILRGLKYLHSAHILHRDLKPGNILVNNNLQIKICDFGFARKQEFDESC 195 Trichoplax adha...
Q9UBE8       216 YVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESR 295 human
XP_415915    216 YVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESR 295 chicken
Feature 1          # #### #                                     #                                
AAS66356     246 HMTQEVVTQYYRAPEVLMGCQHYTSSIDVWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPPL--SAMTSACE--- 320 zebrafish
AAH68796     288 HMTQEVVTQYYRAPEILMGSRHYTNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSL--EAMRTACE--- 362 African clawed ...
5002208      226 NMTHEVVTQYYRAPELLMGARRYTGAVDIWSVGCIFAELLQRKILFQAAGPIEQLQMIIDLLGTPSQ--EAMKYACE--- 300 Caenorhabditis ...
AAA21125     198 HMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGELLGRRILFQAQNPVQQLELITELLGTPTM--EDMRHACE--- 272 fruit fly
BAE06569     161 YMTQEVVTQYYRAPELLLGARHYGTAVDIWSIGCIFAELLSRRILFQANSPVTQIDMIYNLLMDSNIssTQQFSQRSgnp 240 Ciona intestinalis
AAS00536     207 HMTQEVVTQYYRAPEILVGSKHYTSAVDMWSVGCIFAELLGRRILFQAQSPITQLNLITDLLGTPSM--EDMKYACD--- 281 common urchin
BAG49076     221 HMTQEVVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSL--EAMRTACE--- 295 zebrafish
NP_001082214 218 HMTQEVVTQYYRAPEILMGSRHYRSAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPPL--TAMRSACE--- 292 African clawed ...
XP_001622627 197 IMTQEVVTQYYRSPELLTGSTHYTQAVDIWSVGCIFAELLSRKILFQAQSPVQQLNQIIDLLGTPCL--EDLSKAGSs-- 272 starlet sea ane...
XP_002114970 196 EMTAEVVTQYYRAPEILTGSPHYTSKLDIWSVGCIMAEMISGKVLFEASGPVKQLDMITDYLGTPSL--SEFGGACQ--- 270 Trichoplax adha...
Q9UBE8       296 HMTQEVVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSL--EAMRTACE--- 370 human
XP_415915    296 HMTQEVVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSL--EAMRTACE--- 370 chicken
Feature 1                                                                                        
AAS66356     321 ----GARAHILRGPHKPPSLSVLYMLSDGA--THEAVHLLCRMLVFDPAKRISGSDALSHPYLDEGRLRYHTCMCKCCYs 394 zebrafish
AAH68796     363 ----GAKAHILRGPHKQPSLPVLYTLSSQA--THEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFs 436 African clawed ...
5002208      301 ----GAKNHVLRAGLRAPDTQRLYKIASPDdkNHEAVDLLQKLLHFDPDKRISVEEALQHRYLEEGRLRFHSCMCSCCYt 376 Caenorhabditis ...
AAA21125     273 ----GARTHMLRRAPKPPSFSVLYTLSSHA--THEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFt 346 fruit fly
BAE06569     241 ardmEARAQLYQSVSRMPAAPSTFYHLAPNm-THEAAHLISRLLVWDPNKRVSCAEALRHIYLREGRLRYHTSLCRCCCi 319 Ciona intestinalis
AAS00536     282 ----GARAHLLRMPHKPPCLSALYGLSSHA--THEAVHLLSRMLVFNPDKRISCIDALAHPYLDEGRLRYHTCMCNCCHn 355 common urchin
BAG49076     296 ----GARAHILRGPHKQPSLPVLYTLSSQA--THEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCYt 369 zebrafish
NP_001082214 293 ----GARAHILRGPHKPPSLSVLYMLSGEA--THEAVHLLCRMLLFDPLKRISAKDALAHPYLEEGRLRYHTCMCHCCYs 366 African clawed ...
XP_001622627 273 ---eGATKYILQRPHKPPALASLYNLSNQA--THEAVHLLCRMLVFNPNKRISCIDALSHPYLDEGRLRFHTCMCKCCQt 347 starlet sea ane...
XP_002114970 271 ----AAVQYVLSSKKSPKLRNLMYLVSTDL--SEEAFNFLVKLLKFDPKKRISAAEAMYDPYLQGGRLTYHTYICSCCKp 344 Trichoplax adha...
Q9UBE8       371 ----GAKAHILRGPHKQPSLPVLYTLSSQA--THEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFs 444 human
XP_415915    371 ----GAKAHILRGPHKQPSLPVLYTLSSQA--THEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFs 444 chicken
Feature 1                                                                                    
AAS66356     395 v--psGRVYTRDFEPpadrpf--shnyeqSMHSVWQGKELIHRFitehq--------qgkrVPLCINPQSAAFKTF 458 zebrafish
AAH68796     437 t--ssGRVYTSDFEPitnpkf--ddtfekNLSSVRQVKEIIHQFileqq--------kgnrVPLCINPQSAAFKSF 500 African clawed frog
5002208      377 kpnmpSRLFAQDLDPrhespfdpkwekdmSRLSMFELREKMYQFvmdrp--------alygVALCINPQSAAYKNF 444 Caenorhabditis elegans
AAA21125     347 ts-agMRQYTADFEPsagqpf--ddlwerKLTSVQQVKEEMHKFiaeql--------qtgrVPLCINPQSAAFKSF 411 fruit fly
BAE06569     320 t--aeGIRHAADHDFepvpdsvfddsyedELRTVDDVRNAVTDFinsqp--------cgrkAPLRINPNSAVFPRF 385 Ciona intestinalis
AAS00536     356 t--taGRQYTGEFEPaaphrf--dclyedDLHTVSQVKEALHKFitdrh--------qgntVPLCINPQSAAFKSF 419 common urchin
BAG49076     370 t--ssGRVYTSDFEPvtnpkf--ddgfekNLTSVRQVKEIIHQFileqq--------kgnrVPLCINPQSAAFKSF 433 zebrafish
NP_001082214 367 v--ssGRVYTADFEPtatnrf--ddsyekSLTSVWQVKELVHRFitdqh--------qgkrPPLCINPHSAAFKTF 430 African clawed frog
XP_001622627 348 t--paGRQYVSDFEPvnparf--ddsyeyNLNDISSIKESLYKYvleh---------qgnsVPLCINMASPSFKSF 410 starlet sea anemone
XP_002114970 345 ----gKPLSSCDTEPscykv----fedvhPQISLAAAKHELYTLiknnsrairgqsltistTGLQIMNCTAVLNGK 412 Trichoplax adhaerens
Q9UBE8       445 t--stGRVYTSDFEPvtnpkf--ddtfekNLSSVRQVKEIIHQFileqq--------kgnrVPLCINPQSAAFKSF 508 human
XP_415915    445 t--stGRVYTSDFEPitnpkf--ddtfekNLSSVRQVKEIIHQFileqq--------kgnrVPLCINPQSAAFKSF 508 chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap