Conserved Protein Domain Family
STKc_CDK10

?
cd07845: STKc_CDK10 
Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10
STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. CDK10, also called PISSLRE, is essential for cell growth and proliferation, and acts through the G2/M phase of the cell cycle. CDK10 has also been identified as an important factor in endocrine therapy resistance in breast cancer. CDK10 silencing increases the transcription of c-RAF and the activation of the p42/p44 MAPK pathway, which leads to antiestrogen resistance. Patients who express low levels of CDK10 relapse early on tamoxifen. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The CDK10 subfamily is part of a larger superfamily that includes the catalytic domains of other STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 173742
View PSSM: cd07845
Aligned: 12 rows
Threshold Bit Score: 530.787
Threshold Setting Gi: 159470763
Created: 2-Apr-2007
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                      ####    #            # #                #             #           
Q15131        31 GRCRSVkEFEKLNRIGEGTYGIVYRARDTqtdEIVALKKVRMDkeKDGIPISSLREITLLLRLrHPNIVELKEVVVGnhL 110 human
7303804       45 GRCRPVsEFEKLNRVGEGSYGIVYRARDTrsnEIVALKKVRMDqeKDGLPISGLREIMILKQChHENIVRLREVVVGksL 124 fruit fly
XP_797002     51 GLCRSVsEFEKLNRVGEGTYGIVYRARDMkskEIVALKKVRMEkeKDGLPISGLREIHLLINLrHENVVELHEVVVGqhL 130 purple urchin
NP_001091165  21 GRCRSVkEFEKLNRIGEGTYGIVYRARDTksnEIVALKKVRMDkeKDGIPISSLREITLLLKLrHPNIVELKEVVVGnhL 100 African clawed ...
XP_001622095  28 GSCRPVaEFEKLNRIGEGTYGIVYRAKDTksgKIVALKKVRMEqeRDGIPISGLREITLLLNLrHENIVQLLEVVVGkhL 107 starlet sea ane...
XP_002119686  24 GECRDVtTFEKLNRIGEGTYGIVYRARDKvskEIVALKKVRTEneKEGISISSIREITLLLNLkHKNIVELKEVVVGqrL 103 Ciona intestinalis
XP_002115006  11 GNCRNItEFDKLNRIGEGSYGVVYRARDLdskEIVAIKKIRMEneRDGIPVSSLREITLLVNLkHINIVNLKDVVVGkqL 90  Trichoplax adha...
XP_001742822   3 GSCRSItEFEKLNILGEGTYGVVYRARDSrtgHQVAVKQVKMNqeRGGLPLSSLREITALQQLrHTNVLQLLHVAAGrrL 82  Monosiga brevic...
XP_001419019  16 AALATLtNYEKLGRIGEGTYGVVYKGRCKttgDVVALKKVRMDreRDGMPLTSLREVRILQRVrHENVVRLLRVIQGdaL 95  Ostreococcus lu...
XP_001693526  10 PVVDPVsNYEKLHRIGEGTYGVVYKARDRttgEIVALKRVRFDrsRDGVPVTSVRELRVLQAChHPNIVQLKKVVTGsqA 89  Chlamydomonas r...
NP_001103409  39 GKCRSVkEFEKLNRIGEGTYGIVYRARDTvtdETVALKKVRMDneKEGMPVSSLREITLLLELqHPNIVELKEVVVGnhL 118 chicken
CAZ37442      38 GRCRSVaEFEKLNRIGEGTYGIVYRARDTvskEVVALKKVRMEnvRDGIPISSLREITLLLSIkHPNVVHLREVVVGrsL 117 Schistosoma man...
Feature 1              ####  # ##                                                 # # ## #       
Q15131       111 ESIFLVMGYCEQDLASLLENMp-------------tPFSEAQVKCIVLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCV 177 human
7303804      125 DSIFLVMDFCEQDLASVLDNMs-------------qPFTESEVKCITLQVLKALKYLHSRFMIHRDLKVSNLLMTDKGCI 191 fruit fly
XP_797002    131 DSIFLVMQYCEQDLASLLDNMp-------------sPFTETQVKCLALQMLRGLRYLHDNFVIHRDLKVSNLLLADNGCL 197 purple urchin
NP_001091165 101 ESIFLVMGYCEQDLASLLENMq-------------tPFSEAQVKCICFQLLTGLQYLHESFIVHRDLKVSNLLMTDKGCV 167 African clawed ...
XP_001622095 108 DSLFLSMEYCEQDIASLLDNMs-------------cPFSEAQIKCLMIQLLEGTKYLHEHFIVHRDLKVSNLLLTGKGVL 174 starlet sea ane...
XP_002119686 104 DSIFLVMEYCEQDLANLLDNMt-------------tPFSEAQVKCITLQLLRGLAFLHESFIIHRDLKVSNLLMTDGGVL 170 Ciona intestinalis
XP_002115006  91 DSIFLVMEYCEQDLSSLLYDNmk------------aPFTEPQVKCLSLQLIHGVQYLHHNFVIHRDLKVSNLLLTDKGIL 158 Trichoplax adha...
XP_001742822  83 TSIFLIMEYCEHDLAALVDNMp-------------aPFPEPAVKCLMQQLFAGLDAMHRECLIHRDLKLSNLLLTDHGIL 149 Monosiga brevic...
XP_001419019  96 NNVFLVFEYCEHDLARLIDNVk-------------tTLTTSEVKSLMTQTLRAVEYLHERFIFHRDLKLSNLLLNQRGEL 162 Ostreococcus lu...
XP_001693526  90 DSVFLVFEYCDHDLGRLLDSMtppgggggsggagrrPFSISEVKGLMRQLLEAVSFLHDHWIVHRDIKLSNLLYTHTGHL 169 Chlamydomonas r...
NP_001103409 119 ESIFLVMGYCEQDLASLLENMq-------------tPFSEAQVKCIILQVLKGLQYLHERYIIHRDLKVSNLLMTDKGCV 185 chicken
CAZ37442     118 DSIFLVMEYCEQDMASLLDNMp-------------nPFTESQVKCIMLQIFKGLRYLHENFIIHRDLKVSNLLMNDKGLV 184 Schistosoma man...
Feature 1           #  #             # #### #                                     ##             
Q15131       178 KTADFGLARAYGVPv--KPMTPKVVTLWYRAPELLLGTTTQTTSIDMWAVGCILAELLAHRPLLPGTSEIHQIDLIVQLL 255 human
7303804      192 KVADFGLARMFSNPp--KPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCILGELLLGKPLLPGNSEIAQLDMIIDLL 269 fruit fly
XP_797002    198 KIADFGLARRYGLPv--RPMTPRVVTLWYRAPELLFGSLEQTTAIDMWAAGCILGELLVNKPLMPGASELHQINHIIDLL 275 purple urchin
NP_001091165 168 KIADFGLARAFSTPa--KQMTPKVVTLWYRAPELLLGSTTQTTAIDMWAVGCILAELLAHKPLLPGSSEIQQIDLIIQLL 245 African clawed ...
XP_001622095 175 KIADFGLARTFGYPy--KPMTPVVVTLWYRSPELLLGAKVHTTAVDMWAVGCIFGELLGNKPLLAGKSEINQLQLIVDLL 252 starlet sea ane...
XP_002119686 171 KIADFGLARLYSIPq--TSMTPRVVTLWYRAPELLFGATKYTKSIDTWAAGCILAELLAHKPIFPGKSEIEMIELLIQML 248 Ciona intestinalis
XP_002115006 159 KVADFGLARNYGLPa--APMTPTIVSLWYRAPEVLLGCTKHTLAVDMWSVGCIIAELFDHNVFLKGKSEKDQLDLMCQML 236 Trichoplax adha...
XP_001742822 150 KVADFGLTRVIEDPa--HHMSPTVVTLWYRPPELVFGMKNYTRAVDIWSCGCIFAELLAHEPLFPAKTEVALLEMVIGLL 227 Monosiga brevic...
XP_001419019 163 KLCDFGLARTFEPId-rGSYTPKVVTLWYRAPELLFGCDTYTSAIDMWAVGCIFAEFLKHEPLFPGSTEIEQLNMICALL 241 Ostreococcus lu...
XP_001693526 170 KLCDFGLASRTGHVcpkRDRTPNVVTLWYRAPEVLLGSEEYDESIDLWSCGAILAELLTGEPLFPAASEAEALNMMANLL 249 Chlamydomonas r...
NP_001103409 186 KIADFGLARTYGMPp--QPMTPKVVTLWYRAPELLLGVTTQTTSIDMWAVGCILAELLAHKPLLPGTSEIHQIDLIVQLL 263 chicken
CAZ37442     185 KIADFGLSRPTHSH---NPMTPCVVTLWYRAPEILLGDKNQTKAVDIWSAGCIMGELLLHKPLLPGKTEVHQLELIIDLL 261 Schistosoma man...
Feature 1                                                                                        
Q15131       256 GTPSENIWPGFskLPLVGQYSLRKQPYNNLKHKFPWl--------SEAGLRLLHFLFMYDPKKRATAGDCLESSYFKEKP 327 human
7303804      270 GAPSESIWPGFadLPAVQNFTLSQQPYNNLTPKFHMi--------GQSGRNLLNILFIYNPKTRATAEECLKSKYFVDPP 341 fruit fly
XP_797002    276 GTPNDTIWPGFseLPMVQNFTLKKQPYNNLKAKFTWl--------SQSGLRLLNFLLMYNPKKRATAEESLESSYFKEQP 347 purple urchin
NP_001091165 246 GTPNENIWPGFskLPLVGQYTVRKQPYNNLKHKFPWl--------SEAGLRLLNFLFMYDPKKRATAEDSLASSYFKEKP 317 African clawed ...
XP_001622095 253 GTPNDHIWPGYssLPGVKSISLKHQPYNNLKHKFSWv--------SQAGLSLLNYMLMYDPCKRATAAESLQSSYFVEKP 324 starlet sea ane...
XP_002119686 249 GSPSEEIWPGFseLPAIKTIYLKKQPYNNLKHRFPWv--------SEAGLRLLNLMLLYNPSKRISAQDCIEMSYFKENP 320 Ciona intestinalis
XP_002115006 237 GTPNEAIWEDIrdMPLYGKIILRQQPYNNLKHKFSWl--------SAAGLNLLNSLLTYDPGRRITADETLKLSYFRESP 308 Trichoplax adha...
XP_001742822 228 GAPHESIWPAFrdLPLAHRFHMPHQPYSNLKQRFGFl--------SSTGLDLMQDLLMYDPEKRLSAIAASVHPYFRTAP 299 Monosiga brevic...
XP_001419019 242 GSPNSHIWPGWdaLPHARKFKLPEQPYNFLEINFPKl--------SAAGVNLLDVLLTFDPEKRGTATEALAHPFFQESP 313 Ostreococcus lu...
XP_001693526 250 GAPGERIWPGMsaLPNAAKFVFPAQPYNFLRRHMTAscsagggglSEAGLALLNGLLTYDPARRITARQALRHEWFQEKP 329 Chlamydomonas r...
NP_001103409 264 GTPNENIWPGFskLPLVSQYTLRKQPYNNLKHKFPWl--------SEAGLRLLNFLFMYDPKKRATAKDSLDSSYFKEKP 335 chicken
CAZ37442     262 GTPNDQIWPNLskLPALEKINLKKQPYNNLRHTFPWl--------SDAGLRLLNFLFMYDPSKRARARECCQSSYFREHP 333 Schistosoma man...
Feature 1                    
Q15131       328 LPCEPELMPTFP 339 human
7303804      342 QACDPGMMPTFP 353 fruit fly
XP_797002    348 LPCDKALMPTFP 359 purple urchin
NP_001091165 318 LPCEPQLMPTFP 329 African clawed frog
XP_001622095 325 LPVDADMMPTFP 336 starlet sea anemone
XP_002119686 321 HPCGPDMMPTFP 332 Ciona intestinalis
XP_002115006 309 LPIEPEMMPTFP 320 Trichoplax adhaerens
XP_001742822 300 LPLDPEFMPTFP 311 Monosiga brevicollis MX1
XP_001419019 314 PPKPPAEMPTYP 325 Ostreococcus lucimarinus CCE9901
XP_001693526 330 YLKQPGDMPTFP 341 Chlamydomonas reinhardtii
NP_001103409 336 LPCEPELMPTFP 347 chicken
CAZ37442     334 LPCEPDMMPSFP 345 Schistosoma mansoni

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap