1UW5,1T27,2A1L


Conserved Protein Domain Family
SRPBCC_PITP

?
cd07815: SRPBCC_PITP 
Click on image for an interactive view with Cn3D
Lipid-binding SRPBCC domain of Class I and Class II Phosphatidylinositol Transfer Proteins
This family includes the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of the phosphatidylinositol transfer protein (PITP) family of lipid transfer proteins. This family of proteins includes Class 1 PITPs (PITPNA/PITPalpha and PITPNB/PITPbeta, Drosophila vibrator and related proteins), Class IIA PITPs (PITPNM1/PITPalphaI/Nir2, PITPNM2/PITPalphaII/Nir3, Drosophila RdgB, and related proteins), and Class IIB PITPs (PITPNC1/RdgBbeta and related proteins). The PITP family belongs to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. In vitro, PITPs bind phosphatidylinositol (PtdIns), as well as phosphatidylcholine (PtdCho) but with a lower affinity. They transfer these lipids from one membrane compartment to another. The cellular roles of PITPs include inositol lipid signaling, PtdIns metabolism, and membrane trafficking. Class III PITPs, exemplified by the Sec14p family, are found in yeast and plants but are unrelated in sequence and structure to Class I and II PITPs and belong to a different superfamily.
Statistics
?
PSSM-Id: 176857
View PSSM: cd07815
Aligned: 14 rows
Threshold Bit Score: 366.653
Threshold Setting Gi: 156083144
Created: 20-Jun-2007
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 36 residues -Click on image for an interactive view with Cn3D
Feature 1:lipid binding site [chemical binding site]
Evidence:
  • Comment:This phospholipid binding site is comprised of a lipid-headgroup binding pocket and two hydrophobic channels which accommodate the acyl chains.
  • Comment:There are subtle differences in the orientation of PtdCho acyl chains, when this lipid is bound to the different PTIP isoforms.
  • Structure:1UW5_A; human PITPNA bound with PtdIns, contacts at 4A
    View structure with Cn3D
  • Structure:1T27_A; human PITPNA bound with 1,2-dioleoyl-PtdCho, contacts at 4A
    View structure with Cn3D
  • Structure:2AIL_A; Rattus norvegicus PITPNB bound with 1,2-dioleoyl-PtdCho, contacts at 4A
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                            ##  #   #  #                  #                  # # # #  # #
1UW5_A          3 LLKEYRVILPVSVDEYQVGQLYSVAEASKNET------------GGGEGVEVLVNEPYEkd-geKGQYTHKIYHLQSKVP 69   human
AAK01444        2 LIKEYHILLPMSLDEYQVAQLYMIQKKSREESs-----------GEGSGVEILANRPYTdgpggSGQYTHKVYHVGSHIP 70   human
Q9UKF7          2 LLKEYRICMPLTVDEYKIGQLYMISKHSHEQS------------DRGEGVEVVQNEPFEdphhgNGQFTEKRVYLNSKLP 69   human
ABF95364        3 KIKEFRIVVPMSMEEYEIGISYTIMKMEQQNT------------NSKEGVEVLQQVPFEdeklgKGQYTSKNYHLQSKIP 70   Japanese rice
EDL44561        2 KLIEFRLAMPLTMEEYKICQQYLLAKVSHEDTentihgvghnkkTDGRSLVLFKKGTYDdengePGDYTFKRMNLVNKIP 81   malaria paras...
XP_629603       2 LIKEYRITLPFTKEEYRLGQKYMTARKTHESS------------NAGDNVQLLEKSSFTdkngvKGTFTHKVFLLKKSLP 69   Dictyostelium...
XP_001761084    3 HITEMRVVLPLTVEEFRRGQRFANFKTNELNT------------SEGQGGQLLSTLPYEhetwgEGIYTHSLYRLGDRLP 70   Physcomitrell...
EEE22643        2 KVFEYRLVLPMTPEQYKRCQLYMVAKASLEDAtkae-----aegAANDCMEILKNEEYTneegdTGQYTHKRINIANKLP 76   Toxoplasma go...
XP_002284874    3 QIKEFRIVMPMSLEEYQIAQMYMVLKMQQQTT------------TSDEGVEVLENRSFQddalgKGQYTSKVYRLQSKVP 70   Vitis vinifera
XP_641182       3 LIKEFRIPLPLTVEEYKVAQLFMVATISKKNT------------SLGEGIEVIENKPYAdg-atTGFFTRKIFHLGGRLP 69   Dictyostelium...
Feature 1           #   #   ## # # # #    # # #   ##      # #                                     
1UW5_A         70 TFVRXLAPegALNIHEKAWNAYPYCRTVItneYXKEd-FLIKIETWHKPDLGtqENVHKLEPEAWKHVEAVYIDIADRSq 148  human
AAK01444       71 GWFRALLPkaALQVEEESWNAYPYTRTRYt-cPFVEk-FSIEIETYYLPDGGqqPNVFNLSGAERRQRILDTIDIVRDAv 148  human
Q9UKF7         70 SWARAVVPk-IFYVTEKAWNYYPYTITEYt-cSFLPk-FSIHIETKYEDNKGs-NDTIFDNEAKDVEREVCFIDIACDEi 145  human
ABF95364       71 SWMKGFAPasALTVHEESWCAYPNSRTVIk-cPLFSk-CSLTIDTVIRPDNGcsENAHNLTSEQLAAREVEVVDIALQSr 148  Japanese rice
EDL44561       82 KWLLNFVDpkYCLIDEKSWNSYPYLKTVYe-aTGFPk-AQVQVESTHHIGYNteDNAFNISDEQLAQRKVVLIDIVNDKv 159  malaria paras...
XP_629603      70 RYASAILPksALKIEEKSWNSYPNTKTIYscpFFGEk-FYLCIESIHKDGRDeeENVFGLSKDILKKRIVDHVDIARDEv 148  Dictyostelium...
XP_001761084   71 DWVTRLIPsnALILDEKTWMAYPYIRTTIs-iPFFNk-LKIEMLSMHANDDGstENIHNLTKTELAIRKVDMIDIAFDDv 148  Physcomitrell...
EEE22643       77 GWLVSWVDprLTVFDEKSWNAFPHLKTTYd-cELFSk-AKVSMISHHLPGVQtdDNALALDAAMLAQRKVVLIDIVNDPv 154  Toxoplasma go...
XP_002284874   71 AWLTTFAPadALTMQEEAWNAYPRCKTVIk-cPYFNk-FCLAIDTVHKADNGqsENVHGLNKKQLAARQVEVIDIASAAr 148  Vitis vinifera
XP_641182      70 TWLRSFAPt-SLQIEEKAWNAYPYCKTSYa-cPLLGdrFSVSIETRYEPDSGtqDNCLNLNSEELSIREVEHIDIVNDPi 147  Dictyostelium...
Feature 1                                                            #     # #          #   #   ##
1UW5_A        149 vlskDYKAEEDP------AKFKSIKTGRGPLGPNWkqelvnqkdcPYXCAYKLVTVKFKWWG-LQNKVENFIHKQE-RRL 220  human
AAK01444      149 a-pgEYKAEEDP------RLYHSVKTGRGPLSDDWarta--aqtgPLMCAYKLCKVEFRYWG-MQAKIEQFIHDVGlRRV 218  human
Q9UKF7        146 p-erYYKESEDP------KHFKSEKTGRGQLREGWrds-----hqPIMCSYKLVTVKFEVWG-LQTRVEQFVHKVV-RDI 211  human
ABF95364      149 ----DYWSKVISapnvdlTAFRSQRTSRGPLLKGWmds-----crPVMTTYKLVIMDAPIWG-LGERLEDCIIAGE-RAL 217  Japanese rice
EDL44561      160 a-ykDYLPEEDP------TIFYSERAQRGKLDENWien-----skVIMTCYKLFNIDIPYFGmFCSKLENWIVTVI-KDS 226  malaria paras...
XP_629603     149 e-gkDVKTDEDP------RMFKSKLTGRGPLTSPNwrk----evnPAMVVYKLVTVNFNYWG-FQNRVENLVQTNGlREV 216  Dictyostelium...
XP_001761084  149 s-krDYRQELDP------KLYVSKKTVRGPLRKGWrgn-----tvPTMCAYKLVKVEANYWG-VQNRAEKLMNNGI-RQI 214  Physcomitrell...
EEE22643      155 a-skAYVESEDP------SRFHSKKAGIGPLRKDWmt------nyPIMTCYKLFVLDFPYFGfMASKVENWITGAM-RDV 220  Toxoplasma go...
XP_002284874  149 ----DYWSYVVGgnsvdfSKFRSAKTGRGPLLEGWqs------cdPVMTAYKLVTVDAPYWG-FGNRLEQAFLAGE-RAL 216  Vitis vinifera
XP_641182     148 d-eaHYKPEEDP------KIFQSVKTGRGKLQNDWmks-----tkPIMCCYKVCKVEFRCWG-VQNKVENFIQRVAlRDT 214  Dictyostelium...
Feature 1         #  #                                   
1UW5_A        221 FTNFHRQLFCWLDKWVDLTXDDIRRXEEETKRQLDEXRQ 259  human
AAK01444      219 MLRAHRQAWCWQDEWTELSMADIRALEEETARMLAQRMA 257  human
Q9UKF7        212 LLIGHRQAFAWVDEWYDMTMDDVREFERATQEATNKKIG 250  human
ABF95364      218 FLACHRLCFAWIDEWYGMTLDQIREMERQTDLLLKKTLK 256  Japanese rice
EDL44561      227 LLKYHRKALSWIDEWIDLTDEQIRAFEAEIQNKLEGFWK 265  malaria parasite P. vivax
XP_629603     217 FLKAHRSLFCWMDEWIDLSEEQIEQFEQSTYQLMMNNTI 255  Dictyostelium discoideum AX4
XP_001761084  215 VLLTHRNAFCWLDEWFDLTLEEITARETLGRQRLKAAVK 253  Physcomitrella patens subsp. patens
EEE22643      221 LLNYHRKAVCWMDEWYELSMADIRKMEEEVKVKLDAIRG 259  Toxoplasma gondii GT1
XP_002284874  217 FLESHRNCFGWIDEWFGMTVQQLRELEEQTNSSLDVKTS 255  Vitis vinifera
XP_641182     215 FFMGHRQIFCWIDQWFDMDMESLREFEKKTNEEMKAQFH 253  Dictyostelium discoideum AX4

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap