1IJ9


Conserved Protein Domain Family
IgC2_VCAM-1

?
cd07689: IgC2_VCAM-1 
Immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1) and similar proteins; member of the C2-set of IgSF domains
The members here are composed of the immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1; also known as Cluster of Differentiation (CD) 106) and similar proteins. During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. The interaction of VCAM-1 binding to the beta1 integrin very late antigen 4 (VLA-4) expressed by lymphocytes and monocytes mediates the adhesion of leucocytes to blood vessel walls, and regulates migration across the endothelium. During metastasis, some circulating cancer cells extravasate to a secondary site by a similar process. VCAM-1 may be involved in organ targeted tumor metastasis and may also act as host receptors for viruses and parasites. VCAM-1 contains seven Ig domains.
Statistics
?
PSSM-Id: 409486
View PSSM: cd07689
Aligned: 6 rows
Threshold Bit Score: 191.215
Threshold Setting Gi: 14278245
Created: 7-Jun-2009
Updated: 17-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 7 residues -Click on image for an interactive view with Cn3D
Feature 1:Ig strand A [structural motif]
Evidence:
  • None

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1      #######                                                                        
1IJ9_A     92 PKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVC 171 human
P19320    116 PKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVC 195 human
Q28260    116 PKDPEIQLSGPLEVGKPVTVTCLVRDVYPFDRLEMNLLNGNDLLQSKDFLEPMEKKSLETKSLEVTFTPTNEDIGKGLVC 195 dog
Q28260    404 PRDPEVEMSGLLVDGNPVTVSCEVPNVYPSDRLEIELFKGETIIESKSFLEDMDKKSLETKSLEMTFIPTTEDTGKVLVC 483 dog
P29533    404 PEDPVIKMSGPLVHGRPVTVNCTVPNVYPFDHLEIELLKGETTLMKKYFLEEMGIKSLETKILETTFIPTIEDTGKSLVC 483 house mouse
P19320    404 PRDPEIEMSGGLVNGSSVTVSCKVPSVYPLDRLEIELLKGETILENIEFLEDTDMKSLENKSLEMTFIPTIEDTGKALVC 483 human
Feature 1                          
1IJ9_A    172 RAKLHIDEMDSVPTVRQAVKE 192 human
P19320    196 RAKLHIDEMDSVPTVRQAVKE 216 human
Q28260    196 RAQLHMDEIDFEPKERETTKE 216 dog
Q28260    484 LAKLHIDEMEFEPKQRQSTQT 504 dog
P29533    484 LARLHSGEMESEPKQRQSVQP 504 house mouse
P19320    484 QAKLHIDDMEFEPKQRQSTQT 504 human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap