Conserved Protein Domain Family
F-BAR_Fer

?
cd07686: F-BAR_Fer 
The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Fer (Fes related) tyrosine kinase
F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. Fer (Fes related) is a cytoplasmic (or nonreceptor) tyrosine kinase expressed in a wide variety of tissues, and is found to reside in both the cytoplasm and the nucleus. It plays important roles in neuronal polarization and neurite development, cytoskeletal reorganization, cell migration, growth factor signaling, and the regulation of cell-cell interactions mediated by adherens junctions and focal adhesions. Fer kinase also regulates cell cycle progression in malignant cells. It contains an N-terminal F-BAR domain, an SH2 domain, and a C-terminal catalytic kinase domain. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules.
Statistics
?
PSSM-Id: 153370
View PSSM: cd07686
Aligned: 4 rows
Threshold Bit Score: 439.11
Threshold Setting Gi: 125817240
Created: 17-Jun-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Comment:based on the structures of the F-BAR domain dimers of human FCHO2, human Pacsin1 and human Pacsin2

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1             #  #      #  ##  #  ##  ##  #   #  #   #                            #  #   
AAA61190       5 SDLKNSHEAVLKLQDWELRLLETVKKFMALRIKSDKEYASTLQNLCNQVDKestvq-mnyvSNVSKSWLLMIQQTEQLSR 83  human
XP_413981      5 SDLKYSHDALLKLQDWELRLLETVKKFMVMRVKSDKEYASTLQNLCNQVDKestcq-ldyiSNVSKSWLLVVQQTEQLSK 83  chicken
XP_693576      5 RDLRNSHEGLMKLQDWELKLLETVKRFMTLRVKSDKEYASLLINISQQVDKhdnssqihyvSHVSKSWTHMVQQTEQLSK 84  zebrafish
NP_001016902   5 KELRSSHDALLKLQDWELRLLETVKKFMALRIKSDKEYASTLQNLCNQMDKesalp-ldyiSNVSNSWLHLVQQTEQLSK 83  western clawed ...
Feature 1                                                                                        
AAA61190      84 IMKTHAEDLNSGPLHRLTMMIKDKQQVKKSYIGVHQQIEAEMIKVTKTELEKLKCSYRQLIKEMNSAKEKYKEALAKGkE 163 human
XP_413981     84 IMKTHAEDLNSGPLHRLTMMIKDKQQVKKSYIGVHQQIEAEMYKVTKTELEKLKSSYRQLIKEVNSAKEKYKEAVAKGkE 163 chicken
XP_693576     85 IMKCHAEELNSGPLHRLTMMIKDKQQVKKSYQSLHQQIESEMNKVTKSDLERLKCTYRQLTKDAVLAREKYKDAVLKGkE 164 zebrafish
NP_001016902  84 IMKTHAEELNAGPLHRLTTLIKDKQHVKKSYNNIHQQIEAEMYKVSKTELEKLKSSYKQLTKEVNSAKEKFKDASTKGkE 163 western clawed ...
Feature 1            #   #                        #       #  #  ##  #   #  #   #   #  ##  # 
AAA61190     164 TEKAKERYDKATMKLHMLHNQYVLALKGAQLHQNQYYDITLPLLLDSLQKMQEEMIKALKGIFDEYSQITSLVTE 238 human
XP_413981    164 TEKAKDRCDKATMKLHMLHNQYVLALKGAQLYQHQYYDTTLPLLLDSLQKMQEEMIKALKGILDEYSQITSLVTE 238 chicken
XP_693576    165 TEKARERYDKATMKLHNLHNQYVLAVKSAQLHQEHYHEFALPLLLDSLQKMQEEMISALKGILEEYSEITSLLTD 239 zebrafish
NP_001016902 164 TEKARDRYDKANMKLHILHNQYVLAVKGAQLHQHQYYDSTLPLLLDSLQKMQEEMIQALKGIFAEYCQITSLVSE 238 western clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap