Conserved Protein Domain Family
F-BAR_Fes

?
cd07685: F-BAR_Fes 
The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Fes (feline sarcoma) tyrosine kinase
F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. Fes (feline sarcoma), also called Fps (Fujinami poultry sarcoma), is a cytoplasmic (or nonreceptor) tyrosine kinase whose gene was first isolated from tumor-causing retroviruses. It is expressed in myeloid, vascular endothelial, epithelial, and neuronal cells, and plays important roles in cell growth and differentiation, angiogenesis, inflammation and immunity, and cytoskeletal regulation. Fes kinase has also been implicated as a tumor suppressor in colorectal cancer. It contains an N-terminal F-BAR domain, an SH2 domain, and a C-terminal catalytic kinase domain. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules. The F-BAR domain of Fes is critical in its role in microtubule nucleation and bundling.
Statistics
?
PSSM-Id: 153369
View PSSM: cd07685
Aligned: 4 rows
Threshold Bit Score: 315.35
Threshold Setting Gi: 115502390
Created: 17-Jun-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Comment:based on the structures of the F-BAR domain dimers of human FCHO2, human Pacsin1 and human Pacsin2

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1             #  #      #  ##  #  ##  ##  #   #  #   #                                   
P07332         7 LCSPQGHGVLQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSLQdsggqsrai----------------------- 63   human
NP_001085865   7 LQCPNGHATLLRLQDTELRVMESMKKCFIQRAKGDKEYSNMLHQISVQvekldqsltpg--------------------- 65   African clawed...
NP_001026742   7 LWCPKGHSELLRLQDSELRLLELMKKWMSQRAKSDREYAGMLHHMFSQlekqeglghlr--------------------- 65   chicken
CAF99543       7 LWCPQAHAALLRLLDSELYLMEVMKKWMSQRAKSEREFSAQLHSMAAMvekldrsqhgagmdyisqlnkvrsspapssvc 86   spotted green ...
Feature 1                                                    #  #                                
P07332        64 -----------------------------spdspisqSWAEITSQTEGLSRLLRQHAEDLNSGPLSKLSLLIRERQQLRK 114  human
NP_001085865  66 ---------------------------lseyssqlseSWATLVSQTENLSQILRKHSEDVNAGPLSKLTILIREKQQLKK 118  African clawed...
NP_001026742  66 ---------------------------atdhssqigeSWWVLASQTETLSQTLRRHAEELAAGPLAKLSILIRDKQQLRK 118  chicken
CAF99543      87 vcvcvcvcvyvlesernktcftftskclsmlfcpveqSWGVLVYQTDTLSHVMKKSAEDLLDGPISKLSLLIRDKQQLRK 166  spotted green ...
Feature 1                                                                         #   #          
P07332       115 TYSEQWqqlq-----------qelTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHH 183  human
NP_001085865 119 SYSEQWqlln-----------qdyMKTTQQDIEKLRCQYRSQVKETFQSKRKYQEACRDKDRDKAKEKYVKNTWKLHALH 187  African clawed...
NP_001026742 119 AFSEQWqqls-----------qeyARTTQQEMEKLKAQYRSLVRDSTQAKRKYQEASKDKEREKAKEKYVRSLWKLYALH 187  chicken
CAF99543     167 TFTEQWnllkqelskvhlytspsrTQVTQTELERMKSSYRQAAKDAAQAKRKLEEASKDKEREKAKERNIKALAKLYELH 246  spotted green ...
Feature 1                      #       #  #  ##  #   #  #   #   #  ##  # 
P07332       184 NRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQD 239  human
NP_001085865 188 NHYVLAVRTAQLHHEHHFLYSLPTLHESMQSIHQEMVQILKNIMQEYSEITSLVQE 243  African clawed frog
NP_001026742 188 NQYVLAVRAAALHHHHHYQRALPTLHESLYSLQQEMVLVLKEILGEYCSISSLVQE 243  chicken
CAF99543     247 NEYVLSVRAARVYHQHHYSRIQPGLLQALQSLQEEMVLMLKEVLLEYFEISSFLNQ 302  spotted green pufferfish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap